Gana 10 pts/$1 + 500 puntos de bonificación al registrarte|
Full Spectrum Clinic Inventory research kit - MiPeptidos
Resumen de Investigación de Full Spectrum Clinic Inventory
Descarga gratuita — resumen bibliográfico en PDF
Resumen bibliográficoDatos HPLCPMIDs + citasEN + ES

Sin spam. Cancela en cualquier momento.

Prueba analítica

Pureza por lote, justo donde los investigadores la buscan.

Cada compuesto incluido muestra su resultado HPLC, referencia de lote y fecha de prueba para que el research brief esté respaldado por evidencia analítica real.

Semaglutide 10mg

Pureza (HPLC)

99.1%
HR-SMGL-2600315
RP-HPLC C18January 21, 2026

Tirzepatide 10mg

Pureza (HPLC)

99.2%
HR-TRZP-2600315
RP-HPLC C18January 2, 2026

Retatrutide 10mg

Pureza (HPLC)

99.4%
HR-RTTR-2600315
RP-HPLC C18March 12, 2026

BPC-157 10mg

Pureza (HPLC)

99.4%
HR-BPC1-2600215
RP-HPLC C18March 20, 2026

TB500 10mg

Pureza (HPLC)

99.8%
HR-TB50-2600315
RP-HPLC C18March 28, 2026

CJC-1295 5mg

Pureza (HPLC)

99.7%
HR-CJC1-2600315
RP-HPLC C18February 27, 2026

Ipamorelin 5mg

Pureza (HPLC)

99.7%
HR-PMRL-2600215
RP-HPLC C18February 27, 2026

MK677 5mg

Pureza (HPLC)

99.1%
HR-MK67-2600315
RP-HPLC C18January 21, 2026

Epithalon 10mg

Pureza (HPLC)

99.5%
HR-PTHL-2600115
RP-HPLC C18February 1, 2026

NAD+ 500mg

Pureza (HPLC)

99.3%
HR-NAD-2600315
RP-HPLC C18February 3, 2026

Semax 10mg

Pureza (HPLC)

99.3%
HR-SMX-2600315
RP-HPLC C18January 23, 2026

TA1 5mg

Pureza (HPLC)

99.7%
HR-THYM-2600215
RP-HPLC C18March 15, 2026

GHK-Cu 50mg

Pureza (HPLC)

99.4%
HR-GHKC-2600115
RP-HPLC C18February 28, 2026

AOD9604 5mg

Pureza (HPLC)

99.8%
HR-D960-2600215
RP-HPLC C18February 16, 2026

Humanin 10mg

Pureza (HPLC)

99.3%
HR-HMNN-2600215
RP-HPLC C18March 11, 2026
Full SpectrumSave 22%

Full Spectrum Clinic Inventory

Stock every specialty in one order

150 vials across 15 compounds.

10x Semaglutide 10mg
10x Tirzepatide 10mg
10x Retatrutide 10mg
10x BPC-157 10mg
Solo para Uso en Investigación.

Solo para Uso en Investigación. Estos kits están destinados únicamente para fines de investigación en laboratorio. No para consumo humano. Los resúmenes públicos reflejan literatura publicada y documentación analítica, no instrucciones de uso humano ni claims terapéuticos.

Paquete de Kit
USD 7,499.00
USD 995.30
Ahorra -USD 6,503.70 (22% off)
Semaglutide 10mg (10mg)
USD 86.95
Tirzepatide 10mg (10mg)
USD 133.95
Retatrutide 10mg (10mg)
USD 95.95
BPC-157 10mg (10mg)
USD 74.95
TB500 10mg (10mg)
USD 58.95
CJC-1295 5mg (5mg)
USD 47.95
Ipamorelin 5mg (5mg)
USD 40.95
MK677 5mg (5mg)
USD 50.00
Epithalon 10mg (10mg)
USD 23.95
NAD+ 500mg (500mg)
USD 74.95
Semax 10mg (10mg)
USD 37.95
TA1 5mg (5mg)
USD 47.95
GHK-Cu 50mg (50mg)
USD 39.95
AOD9604 5mg (5mg)
USD 40.95
Humanin 10mg (10mg)
USD 139.95
COA Incluido
Verificado por HPLC
Envío el Mismo Día
Pruebas de Terceros
Transacciones Seguras· SSL de 256 bits
VISA
AMEX
DISC
Pay
Crypto
COA Incluido
Verificado por HPLC
Cumple con GMP
Pruebas de Terceros
Envío el Mismo Día
Lote Rastreado
Resumen de evidencia

Construido desde investigación publicada, no desde suposiciones.

Cada kit público ahora abre con la prueba: estudios citados, PMIDs, señales rastreadas y documentación por lote en cada componente.

Ventana de observación
8 semanas
Fases de estudio
Estructurado
Endpoints rastreados
4
Rango de publicación
Literatura actual
Estudios destacados
3
PMIDs en página
2
Señales de investigación
4
COAs incluidos
15
Arquitectura del compuesto

Qué hay dentro del kit, a nivel estructural

Detalles químicos clave tomados de cada compuesto incluido para que la página se sienta como un perfil de investigación real, no como una tarjeta genérica de bundle.

Semaglutide 10mg

CAS: 910463-68-2

Semaglutide is a GLP-1 receptor agonist that mimics native GLP-1 to stimulate insulin secretion in a glucose-dependent manner while suppressing glucagon release. The Aib substitution at position 2 confers resistance to DPP-IV enzymatic degradation, and the C18 fatty diacid chain enables high-affinity albumin binding, extending its half-life substantially. It also acts on hypothalamic appetite centers to reduce food intake and delay gastric emptying.

Fórmula molecular
C187H291N45O59
Peso molecular
4113.64 Da
Secuencia
Modified GLP-1(7-37) analog; 31 amino acids with Aib at position 8, Arg at position 34, and a C18 fatty diacid chain via linker at Lys26

Tirzepatide 10mg

CAS: 2023788-19-2

Tirzepatide is a dual GIP and GLP-1 receptor agonist that activates both incretin pathways simultaneously. It stimulates insulin secretion, suppresses glucagon in a glucose-dependent manner, and reduces appetite via central and peripheral signaling. The dual receptor engagement provides synergistic metabolic effects beyond GLP-1 agonism alone, including enhanced lipid metabolism and improved insulin sensitivity.

Fórmula molecular
C225H348N48O68
Peso molecular
4813.45 Da
Secuencia
39-amino acid peptide based on GIP sequence with Aib at positions 2 and 13, and a C20 fatty diacid chain conjugated to Lys20 via a linker; C-terminal amidation

Retatrutide 10mg

CAS: 2381089-83-2

Retatrutide is a triple hormone receptor agonist that simultaneously activates GLP-1, GIP, and glucagon (GCGR) receptors. GLP-1 and GIP agonism drive insulin secretion and appetite suppression, while glucagon receptor activation increases energy expenditure and hepatic lipid oxidation. This triple mechanism addresses multiple metabolic pathways for potentially superior metabolic research and metabolic improvement over dual agonists.

Fórmula molecular
C221H342N46O68
Peso molecular
4731.41 Da
Secuencia
39-amino acid peptide derived from GIP backbone; contains Aib at positions 2 and 20, alpha-methyl-Leu at position 13, and C20 fatty diacid conjugation at Lys17 via linker

BPC-157 10mg

CAS: 137525-51-0

BPC-157 is a synthetic 15-amino acid fragment derived from human gastric body protection compound. It promotes angiogenesis by upregulating VEGF and its receptor VEGFR2, activates the FAK-paxillin pathway to enhance cell migration and wound closure, and modulates the nitric oxide system. It also interacts with the dopaminergic system and has cytoprotective effects on gastrointestinal mucosa, tendons, ligaments, and other connective tissues.

Fórmula molecular
C62H98N16O22
Peso molecular
1419.56 Da
Secuencia
Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val (15 amino acids)

TB500 10mg

CAS: 77591-33-4 (Thymosin Beta-4); 885340-08-9 (synthetic TB-500 fragment)

TB-500 (synthetic thymosin beta-4) is studied for its role in actin dynamics, a core process that helps cells migrate, reorganize, and respond to repair signals. Published literature has examined its interaction with angiogenic signaling, inflammatory pathways, and tissue-remodeling biology across multiple preclinical models. The active region LKKTETQ is considered central to its actin-binding activity.

Fórmula molecular
C212H350N56O78S
Peso molecular
4963.44 Da (full Thymosin Beta-4)
Secuencia
Full TB4: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETTIEQEKQAGES (43 amino acids); Active region: LKKTETQ (residues 17-23)

CJC-1295 5mg

CAS: 446036-97-1

Mod GRF 1-29 is a modified 29-amino acid fragment of GHRH with four amino acid substitutions that prevent enzymatic degradation: D-Ala2 prevents DPP-IV cleavage, Gln8 prevents asparagine rearrangement, Ala15 enhances bioactivity, and Leu27 prevents methionine oxidation. Without the DAC moiety, it produces more physiologic pulsatile GH release patterns, stimulating somatotrophs through GHRH receptors with a much shorter duration of action.

Fórmula molecular
C152H252N44O42
Peso molecular
3367.90 Da
Secuencia
Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 (29 amino acids with D-Ala2, Gln8, Ala15, Leu27 substitutions)

Ipamorelin 5mg

CAS: 170851-70-4

Ipamorelin is a highly selective growth hormone secretagogue that acts on the ghrelin/GHS receptor (GHSR) in the pituitary to stimulate pulsatile GH release. Unlike other GHRPs, ipamorelin does not significantly affect cortisol, ACTH, or prolactin levels at GH-releasing doses, making it the most selective GHS available. It works synergistically with GHRH analogs (like CJC-1295) to amplify GH pulses while maintaining the natural pulsatile release pattern.

Fórmula molecular
C38H49N9O5
Peso molecular
711.85 Da
Secuencia
Aib-His-D-2-Nal-D-Phe-Lys-NH2 (pentapeptide with non-natural amino acids)

MK677 5mg

CAS: 159634-47-6

MK-677 is an orally active, non-peptidic ghrelin receptor (GHSR-1a) agonist that mimics the GH-releasing activity of ghrelin. It stimulates pituitary GH release by binding to GHSR-1a, increasing GH pulse amplitude without altering pulse frequency. It also increases IGF-1 levels, promotes nitrogen retention, and stimulates appetite. Unlike peptide GH secretagogues, it is orally bioavailable and has a long duration of action, maintaining elevated GH and IGF-1 levels with once-daily dosing.

Fórmula molecular
C27H36N4O5S
Peso molecular
528.67 Da
Secuencia
N/A (not a peptide; non-peptidic small molecule)

Epithalon 10mg

CAS: 307297-39-8

Epithalon is a synthetic tetrapeptide based on the natural epithalamin produced by the pineal gland. It activates telomerase (hTERT), the enzyme responsible for adding telomeric repeats to chromosome ends, thereby extending telomere length and increasing cellular replicative capacity. It also stimulates melatonin production from the pineal gland, restoring circadian rhythm function that declines with age. Additionally, it modulates antioxidant enzyme expression and has been shown to extend lifespan in animal models.

Fórmula molecular
C14H22N4O9
Peso molecular
390.35 Da
Secuencia
Ala-Glu-Asp-Gly (tetrapeptide)

NAD+ 500mg

CAS: 53-84-9

NAD+ is an essential coenzyme present in all living cells that serves as an electron carrier in metabolic redox reactions (glycolysis, TCA cycle, oxidative phosphorylation) and as a substrate for NAD+-consuming enzymes including sirtuins (SIRT1-7), PARPs, and CD38. Sirtuins are NAD+-dependent deacetylases that regulate DNA repair, mitochondrial biogenesis, inflammation, and stress resistance. NAD+ levels decline with age, and restoring NAD+ activates these protective pathways, enhancing cellular energy production, DNA repair capacity, and stress resilience.

Fórmula molecular
C21H27N7O14P2
Peso molecular
663.43 Da
Secuencia
N/A (not a peptide; dinucleotide coenzyme)

Semax 10mg

CAS: 80714-61-0

Semax is a synthetic heptapeptide analog of ACTH(4-10) with a stabilizing Pro-Gly-Pro extension. It increases BDNF and TrkB receptor expression, enhances neurotrophic factor signaling, modulates dopaminergic and serotonergic neurotransmission, and provides neuroprotection through antioxidant and inflammatory-pathway mechanisms. Unlike ACTH, Semax has no steroidogenic activity. It improves cerebral circulation, enhances memory consolidation, and has been approved in Russia and Ukraine for stroke recovery and cognitive enhancement.

Fórmula molecular
C37H51N9O10S
Peso molecular
813.92 Da
Secuencia
Met-Glu-His-Phe-Pro-Gly-Pro (heptapeptide; ACTH(4-7) with Pro-Gly-Pro C-terminal extension)

TA1 5mg

CAS: 62304-98-7

Thymosin Alpha 1 is a naturally occurring thymic peptide that acts as an immunomodulator by enhancing T-cell maturation, differentiation, and function. It stimulates the production of Th1 cytokines (IL-2, IFN-gamma) while suppressing Th2 responses, activates dendritic cells and natural killer cells, and enhances antibody responses to vaccines. It signals through TLR2, TLR9, and TLR3 on dendritic cells and modulates the mTOR pathway for immune cell differentiation.

Fórmula molecular
C129H215N33O55
Peso molecular
3108.28 Da
Secuencia
Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN (28 amino acids, N-terminal acetylation)

GHK-Cu 50mg

CAS: 49557-75-7

GHK-Cu is a naturally occurring copper-binding tripeptide found in human plasma, saliva, and urine. It functions as a signaling molecule that resets gene expression to a healthier state, upregulating genes involved in antioxidant defense, DNA repair, and tissue remodeling while downregulating inflammatory and tissue-destructive genes. It stimulates collagen synthesis, glycosaminoglycan production, and angiogenesis. The copper ion is essential for activating copper-dependent enzymes like lysyl oxidase (collagen cross-linking) and superoxide dismutase.

Fórmula molecular
C14H24CuN6O4
Peso molecular
403.93 Da
Secuencia
Gly-His-Lys (tripeptide complexed with copper(II) ion)

AOD9604 5mg

CAS: 221231-10-3

AOD9604 is a modified 16-amino acid fragment of human growth hormone spanning residues 176-191 with a tyrosine substitution. It stimulates lipolysis (fat breakdown) and inhibits lipogenesis (fat formation) without affecting blood glucose levels or growth parameters. Unlike full HGH, it does not compete for the GH receptor and does not induce IGF-1 elevation or insulin resistance, specifically targeting fat metabolism pathways.

Fórmula molecular
C78H123N23O23S2
Peso molecular
1815.10 Da
Secuencia
YLRIVQCRSVEGSCGF (16 amino acids; HGH residues 176-191 with Tyr at N-terminus replacing Phe)

Humanin 10mg

CAS: 330936-69-1

Humanin is a mitochondrial-derived peptide encoded by the MT-RNR2 gene (16S ribosomal RNA). It exerts cytoprotective effects by binding to IGFBP-3 (blocking its pro-apoptotic effects), binding to BAX (preventing mitochondrial membrane permeabilization and apoptosis), and activating the STAT3 signaling pathway via the CNTFR/WSX-1/gp130 receptor complex. Humanin protects neurons from amyloid-beta toxicity and has broad anti-apoptotic, inflammatory-pathway, and metabolic regulatory functions.

Fórmula molecular
C119H204N34O32S2
Peso molecular
2687.28 Da
Secuencia
MAPRGFSCLLLLTSEIDLPVKRRA (24 amino acids; mitochondria-derived)
Por qué existe este kit

Por qué estos compuestos se combinan en la literatura

Resúmenes en lenguaje claro de los mecanismos y combinaciones publicadas que hacen que este kit tenga sentido para investigación real.

1
Semaglutide 10mg

Stock every specialty in one order. 10 vials each of 15 of our top compounds spanning metabolic signaling research, repair-signaling research, GH, cognitive, immune, and cellular aging. The clinic-in-a-box at wholesale pricing that gives you a 28% margin on everything.

Péptidos Incluidos

Qué Incluye Este Kit

15 péptidos, cada uno con documentación COA individual

Semaglutide 10mg

Semaglutide 10mg

$86.95

glucose-regulation research glucose-regulation research · energy-balance research and metabolic signaling research · cardiometabolic research in diabetic populations

Semaglutide is a GLP-1 receptor agonist that mimics native GLP-1 to stimulate insulin secretion in a glucose-dependent manner while suppressing glucagon release.

10mgGLP-1 / Weight Management
Tirzepatide 10mg

Tirzepatide 10mg

$133.95

glucose-regulation research with superior HbA1c reduction · energy-balance research treatment with significant metabolic research outcomes · Dual incretin receptor pharmacology studies

Tirzepatide is a dual GIP and GLP-1 receptor agonist that activates both incretin pathways simultaneously.

10mgGLP-1 / Weight Management
Retatrutide 10mg

Retatrutide 10mg

$95.95

energy-balance research with extreme metabolic research potential (>24% in trials) · glucose-regulation research management · Triple incretin receptor pharmacology

Retatrutide is a triple hormone receptor agonist that simultaneously activates GLP-1, GIP, and glucagon (GCGR) receptors.

10mgGLP-1 / Weight Management
BPC-157 10mg

BPC-157 10mg

$74.95

Tendon, ligament, and muscle repair biology · Gastrointestinal ulcer and IBD research · Neuroprotection and nerve regeneration

BPC-157 is a synthetic 15-amino acid fragment derived from human gastric body protection compound.

10mgHealing / Recovery
TB500 10mg

TB500 10mg

$58.95

Dermal wound-repair biology models · Cardiac injury and migration signaling research · Inflammatory pathway and remodeling studies

TB-500 (synthetic thymosin beta-4) is studied for its role in actin dynamics, a core process that helps cells migrate, reorganize, and respond to repair signals.

10mgHealing / Recovery
CJC-1295 5mg

CJC-1295 5mg

$47.95

Pulsatile GH release studies · Combination protocols with GHRPs (e.g., Ipamorelin) · Growth hormone axis assessment

Mod GRF 1-29 is a modified 29-amino acid fragment of GHRH with four amino acid substitutions that prevent enzymatic degradation: D-Ala2 prevents DPP-IV cleavage, Gln8 prevents asparagine rearrangement, Ala15 enhances bioactivity, and Leu27 prevents methionine oxidation.

5mgGrowth Hormone / GH Secretagogues
Ipamorelin 5mg

Ipamorelin 5mg

$40.95

Selective GH secretion without cortisol elevation · Synergistic combination with GHRH analogs · Bone density and growth studies

Ipamorelin is a highly selective growth hormone secretagogue that acts on the ghrelin/GHS receptor (GHSR) in the pituitary to stimulate pulsatile GH release.

5mgGrowth Hormone / GH Secretagogues
MK677 5mg

MK677 5mg

$50.00

Oral GH secretagogue pharmacology · Muscle wasting and sarcopenia · Bone density improvement

MK-677 is an orally active, non-peptidic ghrelin receptor (GHSR-1a) agonist that mimics the GH-releasing activity of ghrelin.

5mgGrowth Hormone / GH Secretagogues
Epithalon 10mg

Epithalon 10mg

$23.95

Telomerase activation and telomere elongation · cellular aging and lifespan extension · Circadian rhythm and melatonin restoration

Epithalon is a synthetic tetrapeptide based on the natural epithalamin produced by the pineal gland.

10mgAnti-Aging / Longevity
NAD+ 500mg

NAD+ 500mg

$74.95

Age-related NAD+ decline and supplementation · Sirtuin biology and activation · DNA repair and genomic stability

NAD+ is an essential coenzyme present in all living cells that serves as an electron carrier in metabolic redox reactions (glycolysis, TCA cycle, oxidative phosphorylation) and as a substrate for NAD+-consuming enzymes including sirtuins (SIRT1-7), PARPs, and CD38.

500mgAnti-Aging / Longevity
Semax 10mg

Semax 10mg

$37.95

Cognitive enhancement and memory consolidation · Stroke recovery and neuroprotection · BDNF and neurotrophin pathway upregulation

Semax is a synthetic heptapeptide analog of ACTH(4-10) with a stabilizing Pro-Gly-Pro extension.

10mgCognitive / Neuropeptides
TA1 5mg

TA1 5mg

$47.95

Hepatitis B and C treatment (approved in some countries) · oncology immunotherapy adjunct · Vaccine response enhancement

Thymosin Alpha 1 is a naturally occurring thymic peptide that acts as an immunomodulator by enhancing T-cell maturation, differentiation, and function.

5mgHealing / Recovery
GHK-Cu 50mg

GHK-Cu 50mg

$39.95

Wound repair biology and tissue remodeling · Skin regeneration and cellular aging · Hair growth stimulation (follicle enlargement)

GHK-Cu is a naturally occurring copper-binding tripeptide found in human plasma, saliva, and urine.

50mgHealing / Recovery
AOD9604 5mg

AOD9604 5mg

$40.95

Fat metabolism and lipolysis · energy-balance research treatment without growth effects · Cartilage repair and osteoarthritis

AOD9604 is a modified 16-amino acid fragment of human growth hormone spanning residues 176-191 with a tyrosine substitution.

5mgGLP-1 / Weight Management
Humanin 10mg

Humanin 10mg

$139.95

Alzheimer's disease and amyloid-beta neuroprotection · Mitochondrial-derived peptide biology · Anti-apoptotic signaling pathways

Humanin is a mitochondrial-derived peptide encoded by the MT-RNR2 gene (16S ribosomal RNA).

10mgAnti-Aging / Longevity
Lectura por péptido

Profundiza en los péptidos dentro del kit

Selección de artículos ligada directamente a los compuestos de este kit, para que el investigador pase del bundle a la literatura, el mecanismo y el manejo específico de cada péptido.

Ver la biblioteca completa

Comienza tu Investigación

Get the complete Full Spectrum Clinic Inventory at $7499.00 — save $-6503.70 versus purchasing each compound separately. Full COA documentation included with every vial.

Solo para Uso en Investigación. Estos kits están destinados únicamente para fines de investigación en laboratorio. No para consumo humano. Los resúmenes públicos reflejan literatura publicada y documentación analítica, no instrucciones de uso humano ni claims terapéuticos.