TB500 - Front - MiPeptidos
Healing / Recovery

TB500

CAS: 77591-33-4 (Thymosin Beta-4); 885340-08-9 (synthetic TB-500 fragment)

TB500 is a research peptide in the healing / recovery category. TB-500 (synthetic thymosin beta-4) is a naturally occurring peptide that promotes tissue repair by sequestering G-actin and promoting actin polymerization, which drives cell migration to injury sites. MiPeptidos offers TB500 in 3 sizes with 99.8% verified purity and full analytical documentation.

Starting at
$16.95/vial
In Stock
Ships same day
Request Quote
≥99% Purity
COA Included
Third-Party Tested
Same-Day Shipping
CoA Included
HPLC Verified
GMP Compliant
Third-Party Tested
Same-Day Shipping
Batch Tracked

How TB500 Works

TB-500 (synthetic thymosin beta-4) is a naturally occurring peptide that promotes tissue repair by sequestering G-actin and promoting actin polymerization, which drives cell migration to injury sites. It upregulates cellular receptors such as CCR-2 and CXCR-4, promotes angiogenesis, reduces inflammation by decreasing pro-inflammatory cytokines, and stimulates hair follicle stem cell migration. The active region LKKTETQ is critical for its actin-binding and wound healing properties.

Research Applications

1
Wound healing and tissue repair
2
Cardiac injury repair and cardioprotection
3
Anti-inflammatory applications
4
Hair growth and follicle regeneration
5
Corneal healing and ocular repair
View Published Research on PubMed →

Pricing

SizePer Vial10-Pack
2mg
$16.95$123.95
5mg
$24.95$181.95
10mgBest Value
$44.95$327.95

Prices shown per vial from 10-pack. Volume discounts available for 50+ vials — contact us.

HPLC Purity Analysis

High-Performance Liquid Chromatography
99.8%purity
mAURetention Time (min)0250500750100005101520253099.8%
Method: RP-HPLC C18 ColumnDetection: UV 220nmMobile Phase: Acetonitrile/Water + 0.1% TFA

Certificate of Analysis

MiPeptidos
TB500
PASSES ALL SPECIFICATIONS
Batch NumberHR-TB50-2600315
Date of AnalysisMarch 28, 2026
Purity (HPLC)99.8%
AppearanceWhite to off-white lyophilized powder
SolubilityFreely soluble in sterile water and bacteriostatic water
Molecular Weight (MS)4963.44 Da (full Thymosin Beta-4) — Confirmed
Endotoxin (LAL)<0.1 EU/mg
Sterility (USP <71>)Passes USP <71>

This COA is a representative sample. A batch-specific Certificate of Analysis with full HPLC chromatograms and mass spectrometry data is included with every MiPeptidos order.

Reconstitution Calculator

Add this much bacteriostatic water:
2.0 mL
2 mg TB500 + 2.0 mL BAC water = 1 mg/mL

Inject bacteriostatic water slowly along the vial wall. Gently swirl until dissolved — never shake. Store reconstituted solution at 2-8°C and use within 30 days.

Download Product Brochure

Get our detailed TB500 product brochure with specifications, research applications, HPLC analysis data, and reconstitution guide. Available in English and Spanish.

Researcher Reviews

4.7/5from 3 reviews
Verified
Rachel Davis, PharmD·Philadelphia, PA

TB-500 from MiPeptidos is our thymosin beta-4 fragment of choice for tissue repair studies. The 43-amino-acid peptide consistently tests at 98.8%+ purity in our lab. We've gone through dozens of vials and never had a qua...

Feb 25, 2026
Verified
Eduardo Ramirez·Monterrey, Mexico

Solid TB-500 quality with verified thymosin beta-4 activity in our cell migration assays. Giving 4 stars because one of our three vials had a slight delay in dissolving during reconstitution, though the final solution wa...

Jan 12, 2026
Verified
Dr. Claire Boucher·Quebec City, QC

TB-500 from MiPeptidos is integral to our wound healing and tissue regeneration research at Laval University. The thymosin beta-4 derivative promotes actin sequestration and cell migration in our scratch assays with rema...

Mar 8, 2026
View All Reviews →

Frequently Asked Questions

TB500 (CAS: 77591-33-4 (Thymosin Beta-4); 885340-08-9 (synthetic TB-500 fragment)) is a research compound, with a molecular weight of 4963.44 Da (full Thymosin Beta-4) in the Healing / Recovery category. TB-500 (synthetic thymosin beta-4) is a naturally occurring peptide that promotes tissue repair by sequestering G-actin and promoting actin polymerization, which drives cell migration to injury sites. It upregulates cellular receptors such as CCR-2 and CXCR-4, promotes angiogenesis, reduces inflammation by decreasing pro-inflammatory cytokines, and stimulates hair follicle stem cell migration. Researchers commonly investigate TB500 for Wound healing and tissue repair, Cardiac injury repair and cardioprotection, Anti-inflammatory applications. Every vial from MiPeptidos includes batch-specific analytical documentation.
TB500 is available in 3 sizes (2mg, 5mg, 10mg), so reconstitution volume depends on which vial you have. For the 2mg size, add 1mL of bacteriostatic water; for the 10mg size, use 2-3mL. Always let the vial warm to room temperature first, inject the water slowly along the vial wall, and swirl gently — never shake. Store reconstituted TB500 at 2-8°C and use within 30 days. MiPeptidos carries bacteriostatic water in 3mL and 10mL vials.
TB-500 (Thymosin Beta-4) is a 43-amino acid protein that sequesters G-actin monomers to regulate cytoskeletal dynamics, cell migration, and tissue repair. BPC-157 is a much smaller 15-amino acid gastric peptide focused on angiogenesis via VEGF upregulation. TB-500 has a longer half-life and broader systemic distribution, while BPC-157 tends to concentrate activity at injury sites. Researchers often combine both for synergistic healing — MiPeptidos offers individual vials and pre-blended BPC+TB combos.
Store lyophilized TB500 at -20°C for maximum long-term stability — properly stored, it remains potent for 24+ months. Once reconstituted with bacteriostatic water, keep it refrigerated at 2-8°C and use within 30 days. In research applications, TB500 has a reported half-life of Not precisely established; biological effects persist for days, which informs dosing frequency and protocol design. Avoid repeated freeze-thaw cycles and protect from direct light. MiPeptidos ships every order with cold-chain packaging to maintain integrity during transit.
Every TB500 order from MiPeptidos includes a batch-specific Certificate of Analysis. Our current batch (HR-TB50-2600315, tested March 28, 2026) shows 99.8% purity by HPLC, mass spectrometry confirmation at 4963.44 Da (full Thymosin Beta-4), endotoxin levels below 0.1 EU/mg, and passing sterility per USP <71>. This level of documentation ensures you can verify compound identity and purity before beginning your research. MiPeptidos also offers bulk pricing on orders of 50+ vials — contact info@mipeptidos.com.

Specifications

Purity
≥99%
Form
Lyophilized Powder
CAS Number
77591-33-4 (Thymosin Beta-4); 885340-08-9 (synthetic TB-500 fragment)
Mol. Weight
4963.44 Da (full Thymosin Beta-4)
Formula
C212H350N56O78S
Half-Life
Not precisely established; biological effects persist for days
Storage
Store at -20°C. Reconstituted: 2–8°C for up to 30 days.
Sizes
2mg, 5mg, 10mg

Sequence

Full TB4: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETTIEQEKQAGES (43 amino acids); Active region: LKKTETQ (residues 17-23)

Research Use Only. This product is intended for laboratory research purposes only. Not for human consumption. Handle with appropriate safety precautions.

Request QuoteBulk Pricing Inquiry

Related Peptides

BPC 157 - MiPeptidos
Best Seller
Ships Today
Healing / Recovery

BPC 157

A pentadecapeptide derived from human gastric juice, BPC 157 is one of the most studied peptides in tissue repair research. Investigated for tendon, ligament, muscle, and gut healing.

From$8.95/vial
3 sizesIn Stock
≥99%
BPC 5mg + TB 5mg - MiPeptidos
Ships Today
Healing / Recovery

BPC 5mg + TB 5mg

A combination blend of BPC 157 and TB500 in a single vial. Researched for potential synergistic effects in tissue repair and recovery protocols.

From$42.95/vial
In Stock
≥99%
BPC 10mg + TB 10mg - MiPeptidos
Ships Today
Healing / Recovery

BPC 10mg + TB 10mg

A higher-dose combination blend of BPC 157 and TB500. Designed for research requiring larger quantities of both peptides in a convenient single-vial format.

From$74.95/vial
In Stock
≥99%
GLOW (BPC 157 10mg + GHK-Cu 50mg + TB500 10mg) - MiPeptidos
Ships Today
Healing / Recovery

GLOW (BPC 157 10mg + GHK-Cu 50mg + TB500 10mg)

A triple-peptide blend combining BPC 157, GHK-Cu, and TB500. Formulated for research into comprehensive tissue repair, collagen synthesis, and regenerative pathways.

From$80.95/vial
In Stock
≥99%