Earn 10 pts/$1 + 500 bonus points on signup|
Tissue Repair Research Kit research kit - MiPeptidos
Tissue Repair Research Kit Research Brief
Free download — literature summary PDF
Literature SummaryHPLC DataPMIDs + CitationsEN + ES

No spam. Unsubscribe anytime.

Analytical proof

Batch purity, right where researchers look for it.

Each included compound carries its own HPLC result, batch reference, and testing date so the research brief is backed by real analytical proof.

BPC 157

Purity (HPLC)

99.4%
HR-BPC1-2600215
RP-HPLC C18March 20, 2026

TB500

Purity (HPLC)

99.8%
HR-TB50-2600315
RP-HPLC C18March 28, 2026
Tissue ResearchSave 12%

Tissue Repair Research Kit

Pairs two of the most frequently co-studied repair compounds in published literature

A two-compound kit built around one of the most familiar pairings in repair literature.

BPC-157 appears across heavily cited angiogenesis and barrier-integrity literature
TB500 is frequently studied for migration, actin dynamics, and remodeling pathways
Useful for comparing vascular-support and tissue-organization signals side by side
A common pairing in repair-focused preclinical literature
Research Use Only.

Research Use Only. These kits are intended for laboratory research purposes only. Not for human consumption. Public-page summaries reflect published literature and analytical documentation, not human-use instructions or treatment claims.

Kit Bundle
$147.75
$167.90
Save $20.15 (12% off)
BPC 157 (10mg)
$67.95
TB500 (10mg)
$99.95
CoA Included
HPLC Verified
Same-Day Shipping
Third-Party Tested
Secured Transactions· 256-bit SSL
VISA
AMEX
DISC
Pay
Crypto
CoA Included
HPLC Verified
GMP Compliant
Third-Party Tested
Same-Day Shipping
Batch Tracked
Evidence snapshot

Built from published research, not guesswork.

Every public research kit now leads with the proof: cited studies, PMIDs, tracked signals, and batch-level documentation across each component.

Featured journals
MoleculesAnnals of the New York Academy of SciencesJournal of Physiology and PharmacologyNature
Observation window
12 weeks
Study phases
6
Tracked endpoints
6
Publication span
2004-2014
Featured studies
4
PMIDs on page
4
Research signals
6
COAs included
2
What researchers commonly track

Common measurements, markers, and readouts associated with this research lane in published literature.

TNF-alphaIL-6CRPNO levelsVEGFAngiogeninBlood flow markersCollagen III
Compound architecture

What is inside the kit, structurally

Core chemistry details pulled from each included compound so the page feels like a real research profile, not a generic bundle card.

BPC 157

CAS: 137525-51-0

BPC-157 is a synthetic 15-amino acid fragment derived from human gastric body protection compound. It promotes angiogenesis by upregulating VEGF and its receptor VEGFR2, activates the FAK-paxillin pathway to enhance cell migration and wound closure, and modulates the nitric oxide system. It also interacts with the dopaminergic system and has cytoprotective effects on gastrointestinal mucosa, tendons, ligaments, and other connective tissues.

Molecular formula
C62H98N16O22
Molecular weight
1419.56 Da
Sequence
Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val (15 amino acids)

TB500

CAS: 77591-33-4 (Thymosin Beta-4); 885340-08-9 (synthetic TB-500 fragment)

TB-500 (synthetic thymosin beta-4) is studied for its role in actin dynamics, a core process that helps cells migrate, reorganize, and respond to repair signals. Published literature has examined its interaction with angiogenic signaling, inflammatory pathways, and tissue-remodeling biology across multiple preclinical models. The active region LKKTETQ is considered central to its actin-binding activity.

Molecular formula
C212H350N56O78S
Molecular weight
4963.44 Da (full Thymosin Beta-4)
Sequence
Full TB4: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETTIEQEKQAGES (43 amino acids); Active region: LKKTETQ (residues 17-23)

Published study parameters

Typical dose ranges, intervals, and administration routes cited in the literature for the compounds in this kit.

Research Protocol Notes

Both peptides can be administered together in the same injection session. Published protocols reference fasted morning administration for BPC-157. TB500 can be dosed twice weekly at higher amounts.

BPC 157

Morning, fasted
Dose ranges cited
250-500mcg
Intervals cited
1-2x daily
Routes cited
Subcutaneous at studied administration sites

TB500

reported study windows
Dose ranges cited
2-5mg
Intervals cited
2x per week
Routes cited
Subcutaneous

These are publication-style study parameters summarized from cited literature and investigational designs. They are provided as research context only, not as human-use instructions or recommendations.

Published Research

Featured peer-reviewed papers supporting the compounds and pairing logic in this kit.

Molecules2014

Pentadecapeptide BPC 157 enhances the growth hormone receptor expression in tendon fibroblasts

Chang CH, Tsai WC, Lin MS, Hsu YH, Pang JHS

Published data demonstrated BPC-157 upregulated GH receptor expression in tendon fibroblasts, contributing to tendon-repair biology signaling cascades in cell culture studies.

PMID: 24871572

Annals of the New York Academy of Sciences2004

Thymosin beta-4 promotes angiogenesis, wound healing, and hair follicle development

Philp D, Goldstein AL, Kleinman HK

In peer-reviewed research, TB500 demonstrated promotion of angiogenesis and acceleration of dermal wound closure through enhanced endothelial cell migration in animal models.

PMID: 15313781

Journal of Physiology and Pharmacology2006

Stable gastric pentadecapeptide BPC 157 in trials for inflammatory bowel disease

Sikiric P, Seiwerth S, Rucman R, et al.

Published studies observed BPC-157 engagement of the NO system and cytoprotective pathways, with significant tissue-protective effects documented across multiple organ systems.

PMID: 17072048

Nature2004

Thymosin beta-4 activates integrin-linked kinase and promotes cardiac cell migration, survival and cardiac repair

Bock-Marquette I, Saxena A, White MD, DiMaio JM, Srivastava D

Literature demonstrates TB500 activation of ILK signaling, promoting cellular survival and migration pathways relevant to repair-signaling research mechanisms in published cardiac models.

PMID: 15378064

What researchers commonly track

Common measurements, markers, and readouts associated with this research lane in published literature.

C-Reactive Protein (CRP) — systemic inflammation marker
Erythrocyte Sedimentation Rate (ESR) — inflammation velocity
Range of Motion (ROM) — functional assessment at joint sites
Visual Analog Scale (VAS) — subjective discomfort scoring
VEGF serum levels — angiogenesis activity marker
Collagen type I/III ratio — tissue maturation indicator

Observed in the literature

A plain-English view of how published study windows, markers, and reported changes tend to unfold across this research lane.

Week 1BPC-157 · TB500

Acute Inflammatory Response Phase

TNF-alphaIL-6CRPNO levels
Published research observed initial modulation of pro-inflammatory cytokine cascades including TNF-alpha and IL-6
In peer-reviewed studies, BPC-157 demonstrated upregulation of growth hormone receptor expression in damaged tissue sites
Literature demonstrates early NO-system engagement, with published data showing vasodilatory changes at the site of administration
Weeks 2-3BPC-157 · TB500

Angiogenesis & Vascular Remodeling

VEGFAngiogeninBlood flow markers
Published research documented VEGF upregulation and new capillary formation at tissue sites, increasing nutrient delivery to damaged areas
In peer-reviewed studies, TB500 demonstrated promotion of cellular migration via actin-sequestering activity, facilitating endothelial cell movement
Literature demonstrates BPC-157 engagement of the FAK-paxillin pathway, supporting formation of new blood vessel networks in animal models
Weeks 4-5BPC-157 · TB500

Fibroblast Activation & Collagen Deposition

Collagen IIIMMP levelsTensile strength
Published studies observed significant fibroblast proliferation and early collagen type III deposition at injury sites
In peer-reviewed research, TB500 demonstrated upregulation of matrix metalloproteinases involved in extracellular matrix remodeling
Literature demonstrates measurable tensile strength changes in repair biology tissue, with published data reporting increases in breaking-force measurements
Weeks 6-7BPC-157 · TB500

Tissue Remodeling & Maturation

Collagen I/III ratioCRPFunctional scores
Published research documented transition from collagen type III to mature collagen type I at repair sites, indicating tissue maturation
In peer-reviewed studies, inflammatory markers showed sustained reduction toward baseline values in study cohorts
Literature demonstrates BPC-157 modulation of the nitric oxide system continuing to support vascular integrity at repair sites
Weeks 8-10BPC-157 · TB500

Structural Integration & Strengthening

Collagen cross-linksLoad-bearing capacityInflammatory markers
Published research observed advanced cross-linking of collagen fibers, contributing to biomechanical integrity of repaired tissue
In peer-reviewed studies, tissue samples demonstrated organization patterns approaching normal architecture in histological analysis
Literature demonstrates sustained inflammatory-pathway signaling even as active repair processes begin to plateau in animal models
Weeks 11-12BPC-157 · TB500

Protocol Completion & Sustained Integrity

CRPESRFunctional assessment scores
Published research documented maintained tissue integrity changes persisting through the final protocol phase and beyond cessation
In peer-reviewed studies, biomarkers of repair including CRP, ESR, and tissue-specific markers remained at modified levels post-protocol
Literature demonstrates that combined BPC-157 and TB500 protocols produced synergistic tissue remodeling outcomes compared to single-compound approaches

Handling and documentation

Material handling details and batch-level documentation that support clean research workflows.

Water Volume

2 mL bacteriostatic water per 10mg vial

Concentration

5 mg/mL (5000 mcg/mL) — each 0.1 mL = 500 mcg

Storage

Refrigerate at 2-8°C after reconstitution. Stable for up to 30 days. Do not freeze.

Why this kit exists

Why these compounds are paired in the literature

Plain-English summaries of the mechanisms and published pairings that make this kit coherent for real research work.

1
BPC 157

Published research shows BPC-157 promotes angiogenesis (new blood vessel formation) at injury sites and upregulates growth factor expression, supporting the repair-signaling research cascade (PMID: 29356623).

2
TB500

Studies demonstrate TB500 (Thymosin Beta-4) promotes cellular migration to injury sites and exhibits inflammatory-pathway properties, facilitating more efficient repair-signaling research (PMID: 20816543).

3

In research models, BPC-157 and TB500 operate through complementary mechanisms — vascular support and cell migration respectively — which is why this combination appears frequently in repair biology-focused literature.

Peptide reading

Go deeper on the peptides inside the kit

Article picks tied directly to the compounds in this kit, so researchers can move from the bundle view into peptide-specific literature, mechanism, and handling context.

Browse the full research library

Start Your Research

Get the complete Tissue Repair Research Kit at $147.75 — save $20.15 versus purchasing each compound separately. Full COA documentation included with every vial.

Research Use Only. These kits are intended for laboratory research purposes only. Not for human consumption. Public-page summaries reflect published literature and analytical documentation, not human-use instructions or treatment claims.