Earn 10 pts/$1 + 500 bonus points on signup|
Total Wellness Clinic Starter Kit research kit - MiPeptidos
Total Wellness Clinic Starter Kit Research Brief
Free download — literature summary PDF
Literature SummaryHPLC DataPMIDs + CitationsEN + ES

No spam. Unsubscribe anytime.

Analytical proof

Batch purity, right where researchers look for it.

Each included compound carries its own HPLC result, batch reference, and testing date so the research brief is backed by real analytical proof.

BPC-157 10mg

Purity (HPLC)

99.4%
HR-BPC1-2600215
RP-HPLC C18March 20, 2026

TB500 10mg

Purity (HPLC)

99.8%
HR-TB50-2600315
RP-HPLC C18March 28, 2026

CJC-1295 5mg

Purity (HPLC)

99.7%
HR-CJC1-2600315
RP-HPLC C18February 27, 2026

Ipamorelin 5mg

Purity (HPLC)

99.7%
HR-PMRL-2600215
RP-HPLC C18February 27, 2026

Semax 10mg

Purity (HPLC)

99.3%
HR-SMX-2600315
RP-HPLC C18January 23, 2026

Selank 10mg

Purity (HPLC)

99.5%
HR-SLNK-2600115
RP-HPLC C18January 1, 2026

Thymosin Alpha 1 5mg

Purity (HPLC)

99.7%
HR-THYM-2600215
RP-HPLC C18March 15, 2026

LL37 5mg

Purity (HPLC)

99.5%
HR-LL37-2600215
RP-HPLC C18January 9, 2026

Epithalon 10mg

Purity (HPLC)

99.5%
HR-PTHL-2600115
RP-HPLC C18February 1, 2026

NAD+ 500mg

Purity (HPLC)

99.3%
HR-NAD-2600315
RP-HPLC C18February 3, 2026
Multi-SpecialtySave 18%

Total Wellness Clinic Starter Kit

Open your peptide clinic with one order

100 vials across 10 compounds.

10x BPC-157 10mg — retail $22.95/vial ($167.95 10-pack)
10x TB500 10mg — retail $44.95/vial ($327.95 10-pack)
10x CJC-1295 5mg — retail $22.95/vial ($167.95 10-pack)
10x Ipamorelin 5mg — retail $13.95/vial ($101.95 10-pack)
Research Use Only.

Research Use Only. These kits are intended for laboratory research purposes only. Not for human consumption. Public-page summaries reflect published literature and analytical documentation, not human-use instructions or treatment claims.

Kit Bundle
$1,799.00
$546.50
Save -$1,252.50 (18% off)
BPC-157 10mg (10mg)
$67.95
TB500 10mg (10mg)
$99.95
CJC-1295 5mg (5mg)
$47.95
Ipamorelin 5mg (5mg)
$40.95
Semax 10mg (10mg)
$37.95
Selank 10mg (10mg)
$32.95
Thymosin Alpha 1 5mg (5mg)
$47.95
LL37 5mg (5mg)
$71.95
Epithalon 10mg (10mg)
$23.95
NAD+ 500mg (500mg)
$74.95
CoA Included
HPLC Verified
Same-Day Shipping
Third-Party Tested
Secured Transactions· 256-bit SSL
VISA
AMEX
DISC
Pay
Crypto
CoA Included
HPLC Verified
GMP Compliant
Third-Party Tested
Same-Day Shipping
Batch Tracked
Evidence snapshot

Built from published research, not guesswork.

Every public research kit now leads with the proof: cited studies, PMIDs, tracked signals, and batch-level documentation across each component.

Observation window
8 weeks
Study phases
Structured
Tracked endpoints
4
Publication span
Current literature
Featured studies
3
PMIDs on page
2
Research signals
4
COAs included
10
Compound architecture

What is inside the kit, structurally

Core chemistry details pulled from each included compound so the page feels like a real research profile, not a generic bundle card.

BPC-157 10mg

CAS: 137525-51-0

BPC-157 is a synthetic 15-amino acid fragment derived from human gastric body protection compound. It promotes angiogenesis by upregulating VEGF and its receptor VEGFR2, activates the FAK-paxillin pathway to enhance cell migration and wound closure, and modulates the nitric oxide system. It also interacts with the dopaminergic system and has cytoprotective effects on gastrointestinal mucosa, tendons, ligaments, and other connective tissues.

Molecular formula
C62H98N16O22
Molecular weight
1419.56 Da
Sequence
Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val (15 amino acids)

TB500 10mg

CAS: 77591-33-4 (Thymosin Beta-4); 885340-08-9 (synthetic TB-500 fragment)

TB-500 (synthetic thymosin beta-4) is studied for its role in actin dynamics, a core process that helps cells migrate, reorganize, and respond to repair signals. Published literature has examined its interaction with angiogenic signaling, inflammatory pathways, and tissue-remodeling biology across multiple preclinical models. The active region LKKTETQ is considered central to its actin-binding activity.

Molecular formula
C212H350N56O78S
Molecular weight
4963.44 Da (full Thymosin Beta-4)
Sequence
Full TB4: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETTIEQEKQAGES (43 amino acids); Active region: LKKTETQ (residues 17-23)

CJC-1295 5mg

CAS: 446036-97-1

Mod GRF 1-29 is a modified 29-amino acid fragment of GHRH with four amino acid substitutions that prevent enzymatic degradation: D-Ala2 prevents DPP-IV cleavage, Gln8 prevents asparagine rearrangement, Ala15 enhances bioactivity, and Leu27 prevents methionine oxidation. Without the DAC moiety, it produces more physiologic pulsatile GH release patterns, stimulating somatotrophs through GHRH receptors with a much shorter duration of action.

Molecular formula
C152H252N44O42
Molecular weight
3367.90 Da
Sequence
Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 (29 amino acids with D-Ala2, Gln8, Ala15, Leu27 substitutions)

Ipamorelin 5mg

CAS: 170851-70-4

Ipamorelin is a highly selective growth hormone secretagogue that acts on the ghrelin/GHS receptor (GHSR) in the pituitary to stimulate pulsatile GH release. Unlike other GHRPs, ipamorelin does not significantly affect cortisol, ACTH, or prolactin levels at GH-releasing doses, making it the most selective GHS available. It works synergistically with GHRH analogs (like CJC-1295) to amplify GH pulses while maintaining the natural pulsatile release pattern.

Molecular formula
C38H49N9O5
Molecular weight
711.85 Da
Sequence
Aib-His-D-2-Nal-D-Phe-Lys-NH2 (pentapeptide with non-natural amino acids)

Semax 10mg

CAS: 80714-61-0

Semax is a synthetic heptapeptide analog of ACTH(4-10) with a stabilizing Pro-Gly-Pro extension. It increases BDNF and TrkB receptor expression, enhances neurotrophic factor signaling, modulates dopaminergic and serotonergic neurotransmission, and provides neuroprotection through antioxidant and inflammatory-pathway mechanisms. Unlike ACTH, Semax has no steroidogenic activity. It improves cerebral circulation, enhances memory consolidation, and has been approved in Russia and Ukraine for stroke recovery and cognitive enhancement.

Molecular formula
C37H51N9O10S
Molecular weight
813.92 Da
Sequence
Met-Glu-His-Phe-Pro-Gly-Pro (heptapeptide; ACTH(4-7) with Pro-Gly-Pro C-terminal extension)

Selank 10mg

CAS: 129954-34-3

Selank is a synthetic heptapeptide derived from the immunomodulatory peptide tuftsin (Thr-Lys-Pro-Arg) with a C-terminal Pro-Gly-Pro extension that enhances metabolic stability. It modulates the balance of Th1/Th2 cytokines, influences enkephalinase activity, and increases BDNF mRNA expression in the hippocampus. Selank produces anxiolytic effects comparable to benzodiazepines without sedation, cognitive impairment, or dependence by modulating GABAergic neurotransmission and monoamine metabolism in limbic structures.

Molecular formula
C33H57N11O9
Molecular weight
751.89 Da
Sequence
Thr-Lys-Pro-Arg-Pro-Gly-Pro (heptapeptide; tuftsin analog with Pro-Gly-Pro extension)

Thymosin Alpha 1 5mg

CAS: 62304-98-7

Thymosin Alpha 1 is a naturally occurring thymic peptide that acts as an immunomodulator by enhancing T-cell maturation, differentiation, and function. It stimulates the production of Th1 cytokines (IL-2, IFN-gamma) while suppressing Th2 responses, activates dendritic cells and natural killer cells, and enhances antibody responses to vaccines. It signals through TLR2, TLR9, and TLR3 on dendritic cells and modulates the mTOR pathway for immune cell differentiation.

Molecular formula
C129H215N33O55
Molecular weight
3108.28 Da
Sequence
Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN (28 amino acids, N-terminal acetylation)

LL37 5mg

CAS: 154947-66-7

LL-37 is the only human cathelicidin antimicrobial peptide. It adopts an amphipathic alpha-helical structure that directly disrupts microbial membranes through electrostatic interactions with negatively charged lipid bilayers, creating pores that cause bacterial lysis. Beyond direct antimicrobial activity, LL-37 modulates innate immunity by serving as a chemotactic agent for neutrophils, monocytes, and T-cells, promoting wound repair biology through keratinocyte migration and angiogenesis, and modulating TLR signaling.

Molecular formula
C205H340N60O53
Molecular weight
4493.37 Da
Sequence
[LL-37, 37 aa] (37 amino acids)

Epithalon 10mg

CAS: 307297-39-8

Epithalon is a synthetic tetrapeptide based on the natural epithalamin produced by the pineal gland. It activates telomerase (hTERT), the enzyme responsible for adding telomeric repeats to chromosome ends, thereby extending telomere length and increasing cellular replicative capacity. It also stimulates melatonin production from the pineal gland, restoring circadian rhythm function that declines with age. Additionally, it modulates antioxidant enzyme expression and has been shown to extend lifespan in animal models.

Molecular formula
C14H22N4O9
Molecular weight
390.35 Da
Sequence
Ala-Glu-Asp-Gly (tetrapeptide)

NAD+ 500mg

CAS: 53-84-9

NAD+ is an essential coenzyme present in all living cells that serves as an electron carrier in metabolic redox reactions (glycolysis, TCA cycle, oxidative phosphorylation) and as a substrate for NAD+-consuming enzymes including sirtuins (SIRT1-7), PARPs, and CD38. Sirtuins are NAD+-dependent deacetylases that regulate DNA repair, mitochondrial biogenesis, inflammation, and stress resistance. NAD+ levels decline with age, and restoring NAD+ activates these protective pathways, enhancing cellular energy production, DNA repair capacity, and stress resilience.

Molecular formula
C21H27N7O14P2
Molecular weight
663.43 Da
Sequence
N/A (not a peptide; dinucleotide coenzyme)
Why this kit exists

Why these compounds are paired in the literature

Plain-English summaries of the mechanisms and published pairings that make this kit coherent for real research work.

1
BPC-157 10mg

Open your peptide clinic with one order. 10 vials each across 5 specialties — repair-signaling research, GH, cognitive, immune, and cellular aging. 100 vials, everything you need on the shelf day one.

Included Peptides

What's in This Kit

10 peptides, each with individual COA documentation

BPC-157 10mg

BPC-157 10mg

$67.95

Tendon, ligament, and muscle repair biology · Gastrointestinal ulcer and IBD research · Neuroprotection and nerve regeneration

BPC-157 is a synthetic 15-amino acid fragment derived from human gastric body protection compound.

10mgHealing / Recovery
TB500 10mg

TB500 10mg

$99.95

Dermal wound-repair biology models · Cardiac injury and migration signaling research · Inflammatory pathway and remodeling studies

TB-500 (synthetic thymosin beta-4) is studied for its role in actin dynamics, a core process that helps cells migrate, reorganize, and respond to repair signals.

10mgHealing / Recovery
CJC-1295 5mg

CJC-1295 5mg

$47.95

Pulsatile GH release studies · Combination protocols with GHRPs (e.g., Ipamorelin) · Growth hormone axis assessment

Mod GRF 1-29 is a modified 29-amino acid fragment of GHRH with four amino acid substitutions that prevent enzymatic degradation: D-Ala2 prevents DPP-IV cleavage, Gln8 prevents asparagine rearrangement, Ala15 enhances bioactivity, and Leu27 prevents methionine oxidation.

5mgGrowth Hormone / GH Secretagogues
Ipamorelin 5mg

Ipamorelin 5mg

$40.95

Selective GH secretion without cortisol elevation · Synergistic combination with GHRH analogs · Bone density and growth studies

Ipamorelin is a highly selective growth hormone secretagogue that acts on the ghrelin/GHS receptor (GHSR) in the pituitary to stimulate pulsatile GH release.

5mgGrowth Hormone / GH Secretagogues
Semax 10mg

Semax 10mg

$37.95

Cognitive enhancement and memory consolidation · Stroke recovery and neuroprotection · BDNF and neurotrophin pathway upregulation

Semax is a synthetic heptapeptide analog of ACTH(4-10) with a stabilizing Pro-Gly-Pro extension.

10mgCognitive / Neuropeptides
Selank 10mg

Selank 10mg

$32.95

Anxiety reduction without sedation · Immune modulation via tuftsin pathway · Cognitive enhancement and memory

Selank is a synthetic heptapeptide derived from the immunomodulatory peptide tuftsin (Thr-Lys-Pro-Arg) with a C-terminal Pro-Gly-Pro extension that enhances metabolic stability.

10mgCognitive / Neuropeptides
Thymosin Alpha 1 5mg

Thymosin Alpha 1 5mg

$47.95

Hepatitis B and C treatment (approved in some countries) · oncology immunotherapy adjunct · Vaccine response enhancement

Thymosin Alpha 1 is a naturally occurring thymic peptide that acts as an immunomodulator by enhancing T-cell maturation, differentiation, and function.

5mgHealing / Recovery
LL37 5mg

LL37 5mg

$71.95

Antimicrobial defense against bacteria, fungi, and viruses · Wound repair biology and tissue regeneration · Innate immune system modulation

LL-37 is the only human cathelicidin antimicrobial peptide.

5mgHealing / Recovery
Epithalon 10mg

Epithalon 10mg

$23.95

Telomerase activation and telomere elongation · cellular aging and lifespan extension · Circadian rhythm and melatonin restoration

Epithalon is a synthetic tetrapeptide based on the natural epithalamin produced by the pineal gland.

10mgAnti-Aging / Longevity
NAD+ 500mg

NAD+ 500mg

$74.95

Age-related NAD+ decline and supplementation · Sirtuin biology and activation · DNA repair and genomic stability

NAD+ is an essential coenzyme present in all living cells that serves as an electron carrier in metabolic redox reactions (glycolysis, TCA cycle, oxidative phosphorylation) and as a substrate for NAD+-consuming enzymes including sirtuins (SIRT1-7), PARPs, and CD38.

500mgAnti-Aging / Longevity
Peptide reading

Go deeper on the peptides inside the kit

Article picks tied directly to the compounds in this kit, so researchers can move from the bundle view into peptide-specific literature, mechanism, and handling context.

Browse the full research library

Start Your Research

Get the complete Total Wellness Clinic Starter Kit at $1799.00 — save $-1252.50 versus purchasing each compound separately. Full COA documentation included with every vial.

Research Use Only. These kits are intended for laboratory research purposes only. Not for human consumption. Public-page summaries reflect published literature and analytical documentation, not human-use instructions or treatment claims.