LL37 - Front - MiPeptidos
Healing / Recovery

LL37

CAS: 154947-66-7

LL37 is a research peptide in the healing / recovery category. LL-37 is the only human cathelicidin antimicrobial peptide. MiPeptidos offers LL37 in 1 sizes with 99.5% verified purity and full analytical documentation.

Starting at
$45.95/vial
In Stock
Ships same day
Request Quote
≥99% Purity
COA Included
Third-Party Tested
Same-Day Shipping
CoA Included
HPLC Verified
GMP Compliant
Third-Party Tested
Same-Day Shipping
Batch Tracked

How LL37 Works

LL-37 is the only human cathelicidin antimicrobial peptide. It adopts an amphipathic alpha-helical structure that directly disrupts microbial membranes through electrostatic interactions with negatively charged lipid bilayers, creating pores that cause bacterial lysis. Beyond direct antimicrobial activity, LL-37 modulates innate immunity by serving as a chemotactic agent for neutrophils, monocytes, and T-cells, promoting wound healing through keratinocyte migration and angiogenesis, and modulating TLR signaling.

Research Applications

1
Antimicrobial defense against bacteria, fungi, and viruses
2
Wound healing and tissue regeneration
3
Innate immune system modulation
4
Biofilm disruption
5
Anti-inflammatory and immunomodulatory studies
View Published Research on PubMed →

Pricing

SizePer Vial10-Pack
5mg
$45.95$334.95

Prices shown per vial from 10-pack. Volume discounts available for 50+ vials — contact us.

HPLC Purity Analysis

High-Performance Liquid Chromatography
99.5%purity
mAURetention Time (min)0250500750100005101520253099.5%
Method: RP-HPLC C18 ColumnDetection: UV 220nmMobile Phase: Acetonitrile/Water + 0.1% TFA

Certificate of Analysis

MiPeptidos
LL37
PASSES ALL SPECIFICATIONS
Batch NumberHR-LL37-2600215
Date of AnalysisJanuary 9, 2026
Purity (HPLC)99.5%
AppearanceWhite to off-white lyophilized powder
SolubilityFreely soluble in sterile water and bacteriostatic water
Molecular Weight (MS)4493.37 Da — Confirmed
Endotoxin (LAL)<0.1 EU/mg
Sterility (USP <71>)Passes USP <71>

This COA is a representative sample. A batch-specific Certificate of Analysis with full HPLC chromatograms and mass spectrometry data is included with every MiPeptidos order.

Reconstitution Calculator

Add this much bacteriostatic water:
5.0 mL
5 mg LL37 + 5.0 mL BAC water = 1 mg/mL

Inject bacteriostatic water slowly along the vial wall. Gently swirl until dissolved — never shake. Store reconstituted solution at 2-8°C and use within 30 days.

Download Product Brochure

Get our detailed LL37 product brochure with specifications, research applications, HPLC analysis data, and reconstitution guide. Available in English and Spanish.

Customer Reviews

5.0/5from 1 review
Verified
Dr. Priya Sharma·Mumbai, India

LL-37 is a challenging antimicrobial peptide to synthesize at high purity due to its 37-residue cathelicidin sequence. MiPeptidos' product showed strong membrane-disrupting activity in our bacterial susceptibility assays...

Feb 14, 2026
View All Reviews →

Frequently Asked Questions

LL37 (CAS: 154947-66-7) is a research compound, with a molecular weight of 4493.37 Da in the Healing / Recovery category. LL-37 is the only human cathelicidin antimicrobial peptide. It adopts an amphipathic alpha-helical structure that directly disrupts microbial membranes through electrostatic interactions with negatively charged lipid bilayers, creating pores that cause bacterial lysis. Researchers commonly investigate LL37 for Antimicrobial defense against bacteria, fungi, and viruses, Wound healing and tissue regeneration, Innate immune system modulation. Every vial from MiPeptidos includes batch-specific analytical documentation.
To reconstitute your LL37 5mg vial, let it reach room temperature for about 15-20 minutes out of the freezer. Slowly inject 1-2mL of bacteriostatic water along the inside wall of the vial — never aim directly at the peptide cake. Gently swirl until the powder fully dissolves; never shake, as this can denature the peptide. Store reconstituted LL37 at 2-8°C and use within 30 days. MiPeptidos includes bacteriostatic water for purchase alongside all peptides.
LL-37 and Thymosin Alpha-1 are both immunomodulatory peptides, but they work through different mechanisms. LL-37 is a 37-amino acid cathelicidin that directly disrupts microbial membranes and modulates innate immunity via formyl peptide receptors, while Thymosin Alpha-1 is a thymic peptide that enhances T-cell maturation and dendritic cell function for adaptive immunity. LL-37 also promotes angiogenesis and wound healing. MiPeptidos offers both for researchers studying complementary innate vs adaptive immune pathways.
Store lyophilized LL37 at -20°C for maximum long-term stability — properly stored, it remains potent for 24+ months. Once reconstituted with bacteriostatic water, keep it refrigerated at 2-8°C and use within 30 days. In research applications, LL37 has a reported half-life of ~15-20 minutes in serum (rapidly degraded by proteases), which informs dosing frequency and protocol design. Avoid repeated freeze-thaw cycles and protect from direct light. MiPeptidos ships every order with cold-chain packaging to maintain integrity during transit.
Every LL37 order from MiPeptidos includes a batch-specific Certificate of Analysis. Our current batch (HR-LL37-2600215, tested January 9, 2026) shows 99.5% purity by HPLC, mass spectrometry confirmation at 4493.37 Da, endotoxin levels below 0.1 EU/mg, and passing sterility per USP <71>. This level of documentation ensures you can verify compound identity and purity before beginning your research. MiPeptidos also offers bulk pricing on orders of 50+ vials — contact info@mipeptidos.com.

Specifications

Purity
≥99%
Form
Lyophilized Powder
CAS Number
154947-66-7
Mol. Weight
4493.37 Da
Formula
C205H340N60O53
Half-Life
~15-20 minutes in serum (rapidly degraded by proteases)
Storage
Store at -20°C. Reconstituted: 2–8°C for up to 30 days.
Sizes
5mg

Sequence

[LL-37, 37 aa] (37 amino acids)

Research Use Only. This product is intended for laboratory research purposes only. Not for human consumption. Handle with appropriate safety precautions.

Request QuoteBulk Pricing Inquiry

Related Peptides

BPC 157 - MiPeptidos
Best Seller
Ships Today
Healing / Recovery

BPC 157

A pentadecapeptide derived from human gastric juice, BPC 157 is one of the most studied peptides in tissue repair research. Investigated for tendon, ligament, muscle, and gut healing.

From$8.95/vial
3 sizesIn Stock
≥99%
TB500 - MiPeptidos
Best Seller
Ships Today
Healing / Recovery

TB500

A synthetic fraction of the naturally occurring thymosin beta-4 protein. Extensively researched for wound healing, tissue repair, and anti-inflammatory properties.

From$16.95/vial
3 sizesIn Stock
≥99%
BPC 5mg + TB 5mg - MiPeptidos
Ships Today
Healing / Recovery

BPC 5mg + TB 5mg

A combination blend of BPC 157 and TB500 in a single vial. Researched for potential synergistic effects in tissue repair and recovery protocols.

From$42.95/vial
In Stock
≥99%
BPC 10mg + TB 10mg - MiPeptidos
Ships Today
Healing / Recovery

BPC 10mg + TB 10mg

A higher-dose combination blend of BPC 157 and TB500. Designed for research requiring larger quantities of both peptides in a convenient single-vial format.

From$74.95/vial
In Stock
≥99%