Earn 10 pts/$1 + 500 bonus points on signup|
Anti-Aging Premium Clinic Kit research kit - MiPeptidos
Anti-Aging Premium Clinic Kit Research Brief
Free download — literature summary PDF
Literature SummaryHPLC DataPMIDs + CitationsEN + ES

No spam. Unsubscribe anytime.

Analytical proof

Batch purity, right where researchers look for it.

Each included compound carries its own HPLC result, batch reference, and testing date so the research brief is backed by real analytical proof.

Epithalon 10mg

Purity (HPLC)

99.5%
HR-PTHL-2600115
RP-HPLC C18February 1, 2026

FOXO4-DRI 10mg

Purity (HPLC)

99.7%
HR-FX4D-2600115
RP-HPLC C18February 19, 2026

NAD+ 500mg

Purity (HPLC)

99.3%
HR-NAD-2600315
RP-HPLC C18February 3, 2026

MOTS-c 10mg

Purity (HPLC)

99.2%
HR-MTSC-2600115
RP-HPLC C18February 26, 2026

SS-31 10mg

Purity (HPLC)

99.4%
HR-SS31-2600315
RP-HPLC C18February 8, 2026

Pinealon 10mg

Purity (HPLC)

99.7%
HR-PNLN-2600315
RP-HPLC C18February 3, 2026

Humanin 10mg

Purity (HPLC)

99.3%
HR-HMNN-2600215
RP-HPLC C18March 11, 2026

GHK-Cu 50mg

Purity (HPLC)

99.4%
HR-GHKC-2600115
RP-HPLC C18February 28, 2026
LongevitySave 20%

Anti-Aging Premium Clinic Kit

The highest-margin kit: FOXO4-DRI and Humanin drive $1,335+ profit per kit at 35% margin

80 vials across 8 cellular aging compounds.

10x Epithalon 10mg — retail $14.95/vial ($108.95 10-pack)
10x FOXO4-DRI 10mg — retail $188.95/vial ($1,378.95 10-pack) ★ highest margin
10x NAD+ 500mg — retail $54.95/vial ($400.95 10-pack)
10x MOTS-c 10mg — retail $64.95/vial ($473.95 10-pack)
Research Use Only.

Research Use Only. These kits are intended for laboratory research purposes only. Not for human consumption. Public-page summaries reflect published literature and analytical documentation, not human-use instructions or treatment claims.

Kit Bundle
$2,499.00
$868.70
Save -$1,630.30 (20% off)
Epithalon 10mg (10mg)
$23.95
FOXO4-DRI 10mg (10mg)
$234.95
NAD+ 500mg (500mg)
$74.95
MOTS-c 10mg (10mg)
$54.95
SS-31 10mg (10mg)
$240.00
Pinealon 10mg (10mg)
$60.00
Humanin 10mg (10mg)
$139.95
GHK-Cu 50mg (50mg)
$39.95
CoA Included
HPLC Verified
Same-Day Shipping
Third-Party Tested
Secured Transactions· 256-bit SSL
VISA
AMEX
DISC
Pay
Crypto
CoA Included
HPLC Verified
GMP Compliant
Third-Party Tested
Same-Day Shipping
Batch Tracked
Evidence snapshot

Built from published research, not guesswork.

Every public research kit now leads with the proof: cited studies, PMIDs, tracked signals, and batch-level documentation across each component.

Observation window
8 weeks
Study phases
Structured
Tracked endpoints
4
Publication span
Current literature
Featured studies
3
PMIDs on page
2
Research signals
4
COAs included
8
Compound architecture

What is inside the kit, structurally

Core chemistry details pulled from each included compound so the page feels like a real research profile, not a generic bundle card.

Epithalon 10mg

CAS: 307297-39-8

Epithalon is a synthetic tetrapeptide based on the natural epithalamin produced by the pineal gland. It activates telomerase (hTERT), the enzyme responsible for adding telomeric repeats to chromosome ends, thereby extending telomere length and increasing cellular replicative capacity. It also stimulates melatonin production from the pineal gland, restoring circadian rhythm function that declines with age. Additionally, it modulates antioxidant enzyme expression and has been shown to extend lifespan in animal models.

Molecular formula
C14H22N4O9
Molecular weight
390.35 Da
Sequence
Ala-Glu-Asp-Gly (tetrapeptide)

FOXO4-DRI 10mg

CAS: 2460055-10-9

FOXO4-DRI is a retro-inverso peptide (D-amino acid mirror image in reverse sequence) designed to disrupt the interaction between FOXO4 and p53 in senescent cells. In cellular senescence, FOXO4 accumulates in the nucleus and sequesters p53, preventing p53-mediated apoptosis and keeping senescent cells alive. FOXO4-DRI competitively blocks this interaction, freeing p53 to trigger apoptosis selectively in senescent cells while sparing healthy cells. This makes it a targeted senolytic agent.

Molecular formula
C228H388N86O64
Molecular weight
5358.05 Da
Sequence
ltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg (46 amino acids; all D-amino acids in retro-inverso configuration)

NAD+ 500mg

CAS: 53-84-9

NAD+ is an essential coenzyme present in all living cells that serves as an electron carrier in metabolic redox reactions (glycolysis, TCA cycle, oxidative phosphorylation) and as a substrate for NAD+-consuming enzymes including sirtuins (SIRT1-7), PARPs, and CD38. Sirtuins are NAD+-dependent deacetylases that regulate DNA repair, mitochondrial biogenesis, inflammation, and stress resistance. NAD+ levels decline with age, and restoring NAD+ activates these protective pathways, enhancing cellular energy production, DNA repair capacity, and stress resilience.

Molecular formula
C21H27N7O14P2
Molecular weight
663.43 Da
Sequence
N/A (not a peptide; dinucleotide coenzyme)

MOTS-c 10mg

CAS: 1627580-64-6

MOTS-c is a mitochondrial-derived peptide encoded by the 12S rRNA gene (MT-RNR1) that acts as a retrograde signaling molecule from mitochondria to the nucleus. It activates AMPK, enhancing glucose uptake and fatty acid oxidation in skeletal muscle. MOTS-c regulates the folate cycle and de novo purine biosynthesis, leading to AICAR accumulation and subsequent AMPK activation. It translocates to the nucleus under metabolic stress to regulate adaptive gene expression, functioning as an exercise mimetic at the molecular level.

Molecular formula
C101H152N28O22S2
Molecular weight
2174.60 Da
Sequence
MRWQEMGYIFYPRKLR (16 amino acids; mitochondria-derived)

SS-31 10mg

CAS: 736992-21-5

SS-31 is a cell-permeable, mitochondria-targeted tetrapeptide that concentrates ~1000-fold in the inner mitochondrial membrane by binding to cardiolipin, a phospholipid unique to this membrane. By stabilizing cardiolipin's interaction with cytochrome c, SS-31 optimizes electron transport chain efficiency, reduces electron leak, and decreases mitochondrial reactive oxygen species (ROS) production. It does not act as a traditional antioxidant scavenger but rather prevents ROS formation at the source by maintaining proper mitochondrial function.

Molecular formula
C32H49N9O5
Molecular weight
639.80 Da
Sequence
D-Arg-Dmt-Lys-Phe-NH2 (tetrapeptide; Dmt = 2',6'-dimethyltyrosine)

Pinealon 10mg

CAS: 175175-23-2

Pinealon is a synthetic tripeptide bioregulator designed to target the pineal gland and central nervous system. It penetrates cell membranes and reaches the nucleus where it binds to specific DNA sequences to regulate gene expression related to neurotransmitter synthesis, antioxidant enzyme production, and neuroendocrine function. It promotes melatonin synthesis in pinealocytes, has neuroprotective properties against oxidative stress, and modulates neuronal apoptosis through regulation of anti-apoptotic gene expression.

Molecular formula
C15H26N6O8
Molecular weight
418.41 Da
Sequence
Glu-Asp-Arg (tripeptide)

Humanin 10mg

CAS: 330936-69-1

Humanin is a mitochondrial-derived peptide encoded by the MT-RNR2 gene (16S ribosomal RNA). It exerts cytoprotective effects by binding to IGFBP-3 (blocking its pro-apoptotic effects), binding to BAX (preventing mitochondrial membrane permeabilization and apoptosis), and activating the STAT3 signaling pathway via the CNTFR/WSX-1/gp130 receptor complex. Humanin protects neurons from amyloid-beta toxicity and has broad anti-apoptotic, inflammatory-pathway, and metabolic regulatory functions.

Molecular formula
C119H204N34O32S2
Molecular weight
2687.28 Da
Sequence
MAPRGFSCLLLLTSEIDLPVKRRA (24 amino acids; mitochondria-derived)

GHK-Cu 50mg

CAS: 49557-75-7

GHK-Cu is a naturally occurring copper-binding tripeptide found in human plasma, saliva, and urine. It functions as a signaling molecule that resets gene expression to a healthier state, upregulating genes involved in antioxidant defense, DNA repair, and tissue remodeling while downregulating inflammatory and tissue-destructive genes. It stimulates collagen synthesis, glycosaminoglycan production, and angiogenesis. The copper ion is essential for activating copper-dependent enzymes like lysyl oxidase (collagen cross-linking) and superoxide dismutase.

Molecular formula
C14H24CuN6O4
Molecular weight
403.93 Da
Sequence
Gly-His-Lys (tripeptide complexed with copper(II) ion)
Why this kit exists

Why these compounds are paired in the literature

Plain-English summaries of the mechanisms and published pairings that make this kit coherent for real research work.

1
Epithalon 10mg

The highest-margin kit: FOXO4-DRI and Humanin drive $1,335+ profit per kit at 35% margin. 10 vials each of 8 cellular aging compounds covering every hallmark of aging. Premium cellular aging clinics only.

Included Peptides

What's in This Kit

8 peptides, each with individual COA documentation

Epithalon 10mg

Epithalon 10mg

$23.95

Telomerase activation and telomere elongation · cellular aging and lifespan extension · Circadian rhythm and melatonin restoration

Epithalon is a synthetic tetrapeptide based on the natural epithalamin produced by the pineal gland.

10mgAnti-Aging / Longevity
FOXO4-DRI 10mg

FOXO4-DRI 10mg

$234.95

Senescent cell clearance (senolytic therapy) · Aging reversal and rejuvenation · FOXO4/p53 interaction biology

FOXO4-DRI is a retro-inverso peptide (D-amino acid mirror image in reverse sequence) designed to disrupt the interaction between FOXO4 and p53 in senescent cells.

10mgAnti-Aging / Longevity
NAD+ 500mg

NAD+ 500mg

$74.95

Age-related NAD+ decline and supplementation · Sirtuin biology and activation · DNA repair and genomic stability

NAD+ is an essential coenzyme present in all living cells that serves as an electron carrier in metabolic redox reactions (glycolysis, TCA cycle, oxidative phosphorylation) and as a substrate for NAD+-consuming enzymes including sirtuins (SIRT1-7), PARPs, and CD38.

500mgAnti-Aging / Longevity
MOTS-c 10mg

MOTS-c 10mg

$54.95

Metabolic homeostasis and AMPK activation · Exercise mimetic and endurance research · Age-related metabolic decline

MOTS-c is a mitochondrial-derived peptide encoded by the 12S rRNA gene (MT-RNR1) that acts as a retrograde signaling molecule from mitochondria to the nucleus.

10mgAnti-Aging / Longevity
SS-31 10mg

SS-31 10mg

$240.00

Mitochondrial dysfunction and aging · Barth syndrome (FDA-approved indication) · Heart failure and cardiac ischemia-reperfusion

SS-31 is a cell-permeable, mitochondria-targeted tetrapeptide that concentrates ~1000-fold in the inner mitochondrial membrane by binding to cardiolipin, a phospholipid unique to this membrane.

10mgAnti-Aging / Longevity
Pinealon 10mg

Pinealon 10mg

$60.00

Pineal gland function and melatonin synthesis · Neuroprotection and cognitive support · Age-related neuroendocrine decline

Pinealon is a synthetic tripeptide bioregulator designed to target the pineal gland and central nervous system.

10mgAnti-Aging / Longevity
Humanin 10mg

Humanin 10mg

$139.95

Alzheimer's disease and amyloid-beta neuroprotection · Mitochondrial-derived peptide biology · Anti-apoptotic signaling pathways

Humanin is a mitochondrial-derived peptide encoded by the MT-RNR2 gene (16S ribosomal RNA).

10mgAnti-Aging / Longevity
GHK-Cu 50mg

GHK-Cu 50mg

$39.95

Wound repair biology and tissue remodeling · Skin regeneration and cellular aging · Hair growth stimulation (follicle enlargement)

GHK-Cu is a naturally occurring copper-binding tripeptide found in human plasma, saliva, and urine.

50mgHealing / Recovery
Peptide reading

Go deeper on the peptides inside the kit

Article picks tied directly to the compounds in this kit, so researchers can move from the bundle view into peptide-specific literature, mechanism, and handling context.

Browse the full research library
10 min readanti-aging

Anti-Aging & Longevity Peptides

Comprehensive research guide covering mechanism, studies, and practical info for anti-aging peptides.

Epithalon 10mgFOXO4-DRI 10mgHumanin 10mgMOTS-c 10mgSS-31 10mgNAD+ 500mgPinealon 10mg
Read article
11 min readskin

Anti-Aging Peptide Stack: Research Protocol

Longevity community loves stack protocols. Good for multiple product sales. Comprehensive research guide covering mechanism of action, published studies,.

Epithalon 10mgGHK-Cu 50mgNAD+ 500mgFOXO4-DRI 10mgHumanin 10mg
Read article
10 min readanti-aging

Epithalon & Telomere Research

Review of epithalon (epitalon), the synthetic tetrapeptide studied for telomerase activation and cellular aging.

Epithalon 10mgNAD+ 500mgMOTS-c 10mgHumanin 10mgPinealon 10mg
Read article
10 min readanti-aging

NAD+ Peptide Research: Cellular Energy & Aging

Explore NAD+ research in cellular energy metabolism and aging biology. Covers sirtuins, PARP enzymes, and restoration approaches.

NAD+ 500mgEpithalon 10mgMOTS-c 10mgHumanin 10mgSS-31 10mg
Read article
11 min readanti-aging

Mitochondrial Peptides: Research Frontiers

Emerging category. Position as authority early. Comprehensive research guide covering mechanism of action, published studies, and practical information.

MOTS-c 10mgHumanin 10mgSS-31 10mgNAD+ 500mg
Read article
10 min readspecialty

Humanin: Mitochondrial Cytoprotection

Growing longevity community interest. Pairs well with MOTS-c content. Comprehensive research guide covering mechanism of action, published studies, and.

Humanin 10mgMOTS-c 10mgSS-31 10mg
Read article

Start Your Research

Get the complete Anti-Aging Premium Clinic Kit at $2499.00 — save $-1630.30 versus purchasing each compound separately. Full COA documentation included with every vial.

Research Use Only. These kits are intended for laboratory research purposes only. Not for human consumption. Public-page summaries reflect published literature and analytical documentation, not human-use instructions or treatment claims.