Gana 10 pts/$1 + 500 puntos de bonificación al registrarte|
Total Wellness Clinic Starter Kit research kit - MiPeptidos
Resumen de Investigación de Total Wellness Clinic Starter Kit
Descarga gratuita — resumen bibliográfico en PDF
Resumen bibliográficoDatos HPLCPMIDs + citasEN + ES

Sin spam. Cancela en cualquier momento.

Prueba analítica

Pureza por lote, justo donde los investigadores la buscan.

Cada compuesto incluido muestra su resultado HPLC, referencia de lote y fecha de prueba para que el research brief esté respaldado por evidencia analítica real.

BPC-157 10mg

Pureza (HPLC)

99.4%
HR-BPC1-2600215
RP-HPLC C18March 20, 2026

TB500 10mg

Pureza (HPLC)

99.8%
HR-TB50-2600315
RP-HPLC C18March 28, 2026

CJC-1295 5mg

Pureza (HPLC)

99.7%
HR-CJC1-2600315
RP-HPLC C18February 27, 2026

Ipamorelin 5mg

Pureza (HPLC)

99.7%
HR-PMRL-2600215
RP-HPLC C18February 27, 2026

Semax 10mg

Pureza (HPLC)

99.3%
HR-SMX-2600315
RP-HPLC C18January 23, 2026

Selank 10mg

Pureza (HPLC)

99.5%
HR-SLNK-2600115
RP-HPLC C18January 1, 2026

Thymosin Alpha 1 5mg

Pureza (HPLC)

99.7%
HR-THYM-2600215
RP-HPLC C18March 15, 2026

LL37 5mg

Pureza (HPLC)

99.5%
HR-LL37-2600215
RP-HPLC C18January 9, 2026

Epithalon 10mg

Pureza (HPLC)

99.5%
HR-PTHL-2600115
RP-HPLC C18February 1, 2026

NAD+ 500mg

Pureza (HPLC)

99.3%
HR-NAD-2600315
RP-HPLC C18February 3, 2026
Investigacion Multi-SistemaSave 18%

Total Wellness Clinic Starter Kit

Open your peptide clinic with one order

Diez peptidos que abarcan reparacion tisular, optimizacion de GH, mejora cognitiva, modulacion inmune y longevidad celular — el kit de investigacion multi-sistema mas completo disponible para instalaciones de investigacion clinica.

10x BPC-157 10mg — retail $22.95/vial ($167.95 10-pack)
10x TB500 10mg — retail $44.95/vial ($327.95 10-pack)
10x CJC-1295 5mg — retail $22.95/vial ($167.95 10-pack)
10x Ipamorelin 5mg — retail $13.95/vial ($101.95 10-pack)
Solo para Uso en Investigación.

Solo para Uso en Investigación. Estos kits están destinados únicamente para fines de investigación en laboratorio. No para consumo humano. Los resúmenes públicos reflejan literatura publicada y documentación analítica, no instrucciones de uso humano ni claims terapéuticos.

Paquete de Kit
USD 1,799.00
USD 546.50
Ahorra -USD 1,252.50 (18% off)
BPC-157 10mg (10mg)
USD 67.95
TB500 10mg (10mg)
USD 99.95
CJC-1295 5mg (5mg)
USD 47.95
Ipamorelin 5mg (5mg)
USD 40.95
Semax 10mg (10mg)
USD 37.95
Selank 10mg (10mg)
USD 32.95
Thymosin Alpha 1 5mg (5mg)
USD 47.95
LL37 5mg (5mg)
USD 71.95
Epithalon 10mg (10mg)
USD 23.95
NAD+ 500mg (500mg)
USD 74.95
COA Incluido
Verificado por HPLC
Envío el Mismo Día
Pruebas de Terceros
Transacciones Seguras· SSL de 256 bits
VISA
AMEX
DISC
Pay
Crypto
COA Incluido
Verificado por HPLC
Cumple con GMP
Pruebas de Terceros
Envío el Mismo Día
Lote Rastreado
Resumen de evidencia

Construido desde investigación publicada, no desde suposiciones.

Cada kit público ahora abre con la prueba: estudios citados, PMIDs, señales rastreadas y documentación por lote en cada componente.

Ventana de observación
8 semanas
Fases de estudio
Estructurado
Endpoints rastreados
4
Rango de publicación
Literatura actual
Estudios destacados
3
PMIDs en página
2
Señales de investigación
4
COAs incluidos
10
Arquitectura del compuesto

Qué hay dentro del kit, a nivel estructural

Detalles químicos clave tomados de cada compuesto incluido para que la página se sienta como un perfil de investigación real, no como una tarjeta genérica de bundle.

BPC-157 10mg

CAS: 137525-51-0

BPC-157 is a synthetic 15-amino acid fragment derived from human gastric body protection compound. It promotes angiogenesis by upregulating VEGF and its receptor VEGFR2, activates the FAK-paxillin pathway to enhance cell migration and wound closure, and modulates the nitric oxide system. It also interacts with the dopaminergic system and has cytoprotective effects on gastrointestinal mucosa, tendons, ligaments, and other connective tissues.

Fórmula molecular
C62H98N16O22
Peso molecular
1419.56 Da
Secuencia
Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val (15 amino acids)

TB500 10mg

CAS: 77591-33-4 (Thymosin Beta-4); 885340-08-9 (synthetic TB-500 fragment)

TB-500 (synthetic thymosin beta-4) is studied for its role in actin dynamics, a core process that helps cells migrate, reorganize, and respond to repair signals. Published literature has examined its interaction with angiogenic signaling, inflammatory pathways, and tissue-remodeling biology across multiple preclinical models. The active region LKKTETQ is considered central to its actin-binding activity.

Fórmula molecular
C212H350N56O78S
Peso molecular
4963.44 Da (full Thymosin Beta-4)
Secuencia
Full TB4: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETTIEQEKQAGES (43 amino acids); Active region: LKKTETQ (residues 17-23)

CJC-1295 5mg

CAS: 446036-97-1

Mod GRF 1-29 is a modified 29-amino acid fragment of GHRH with four amino acid substitutions that prevent enzymatic degradation: D-Ala2 prevents DPP-IV cleavage, Gln8 prevents asparagine rearrangement, Ala15 enhances bioactivity, and Leu27 prevents methionine oxidation. Without the DAC moiety, it produces more physiologic pulsatile GH release patterns, stimulating somatotrophs through GHRH receptors with a much shorter duration of action.

Fórmula molecular
C152H252N44O42
Peso molecular
3367.90 Da
Secuencia
Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 (29 amino acids with D-Ala2, Gln8, Ala15, Leu27 substitutions)

Ipamorelin 5mg

CAS: 170851-70-4

Ipamorelin is a highly selective growth hormone secretagogue that acts on the ghrelin/GHS receptor (GHSR) in the pituitary to stimulate pulsatile GH release. Unlike other GHRPs, ipamorelin does not significantly affect cortisol, ACTH, or prolactin levels at GH-releasing doses, making it the most selective GHS available. It works synergistically with GHRH analogs (like CJC-1295) to amplify GH pulses while maintaining the natural pulsatile release pattern.

Fórmula molecular
C38H49N9O5
Peso molecular
711.85 Da
Secuencia
Aib-His-D-2-Nal-D-Phe-Lys-NH2 (pentapeptide with non-natural amino acids)

Semax 10mg

CAS: 80714-61-0

Semax is a synthetic heptapeptide analog of ACTH(4-10) with a stabilizing Pro-Gly-Pro extension. It increases BDNF and TrkB receptor expression, enhances neurotrophic factor signaling, modulates dopaminergic and serotonergic neurotransmission, and provides neuroprotection through antioxidant and inflammatory-pathway mechanisms. Unlike ACTH, Semax has no steroidogenic activity. It improves cerebral circulation, enhances memory consolidation, and has been approved in Russia and Ukraine for stroke recovery and cognitive enhancement.

Fórmula molecular
C37H51N9O10S
Peso molecular
813.92 Da
Secuencia
Met-Glu-His-Phe-Pro-Gly-Pro (heptapeptide; ACTH(4-7) with Pro-Gly-Pro C-terminal extension)

Selank 10mg

CAS: 129954-34-3

Selank is a synthetic heptapeptide derived from the immunomodulatory peptide tuftsin (Thr-Lys-Pro-Arg) with a C-terminal Pro-Gly-Pro extension that enhances metabolic stability. It modulates the balance of Th1/Th2 cytokines, influences enkephalinase activity, and increases BDNF mRNA expression in the hippocampus. Selank produces anxiolytic effects comparable to benzodiazepines without sedation, cognitive impairment, or dependence by modulating GABAergic neurotransmission and monoamine metabolism in limbic structures.

Fórmula molecular
C33H57N11O9
Peso molecular
751.89 Da
Secuencia
Thr-Lys-Pro-Arg-Pro-Gly-Pro (heptapeptide; tuftsin analog with Pro-Gly-Pro extension)

Thymosin Alpha 1 5mg

CAS: 62304-98-7

Thymosin Alpha 1 is a naturally occurring thymic peptide that acts as an immunomodulator by enhancing T-cell maturation, differentiation, and function. It stimulates the production of Th1 cytokines (IL-2, IFN-gamma) while suppressing Th2 responses, activates dendritic cells and natural killer cells, and enhances antibody responses to vaccines. It signals through TLR2, TLR9, and TLR3 on dendritic cells and modulates the mTOR pathway for immune cell differentiation.

Fórmula molecular
C129H215N33O55
Peso molecular
3108.28 Da
Secuencia
Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN (28 amino acids, N-terminal acetylation)

LL37 5mg

CAS: 154947-66-7

LL-37 is the only human cathelicidin antimicrobial peptide. It adopts an amphipathic alpha-helical structure that directly disrupts microbial membranes through electrostatic interactions with negatively charged lipid bilayers, creating pores that cause bacterial lysis. Beyond direct antimicrobial activity, LL-37 modulates innate immunity by serving as a chemotactic agent for neutrophils, monocytes, and T-cells, promoting wound repair biology through keratinocyte migration and angiogenesis, and modulating TLR signaling.

Fórmula molecular
C205H340N60O53
Peso molecular
4493.37 Da
Secuencia
[LL-37, 37 aa] (37 amino acids)

Epithalon 10mg

CAS: 307297-39-8

Epithalon is a synthetic tetrapeptide based on the natural epithalamin produced by the pineal gland. It activates telomerase (hTERT), the enzyme responsible for adding telomeric repeats to chromosome ends, thereby extending telomere length and increasing cellular replicative capacity. It also stimulates melatonin production from the pineal gland, restoring circadian rhythm function that declines with age. Additionally, it modulates antioxidant enzyme expression and has been shown to extend lifespan in animal models.

Fórmula molecular
C14H22N4O9
Peso molecular
390.35 Da
Secuencia
Ala-Glu-Asp-Gly (tetrapeptide)

NAD+ 500mg

CAS: 53-84-9

NAD+ is an essential coenzyme present in all living cells that serves as an electron carrier in metabolic redox reactions (glycolysis, TCA cycle, oxidative phosphorylation) and as a substrate for NAD+-consuming enzymes including sirtuins (SIRT1-7), PARPs, and CD38. Sirtuins are NAD+-dependent deacetylases that regulate DNA repair, mitochondrial biogenesis, inflammation, and stress resistance. NAD+ levels decline with age, and restoring NAD+ activates these protective pathways, enhancing cellular energy production, DNA repair capacity, and stress resilience.

Fórmula molecular
C21H27N7O14P2
Peso molecular
663.43 Da
Secuencia
N/A (not a peptide; dinucleotide coenzyme)
Por qué existe este kit

Por qué estos compuestos se combinan en la literatura

Resúmenes en lenguaje claro de los mecanismos y combinaciones publicadas que hacen que este kit tenga sentido para investigación real.

1
BPC-157 10mg

Open your peptide clinic with one order. 10 vials each across 5 specialties — repair-signaling research, GH, cognitive, immune, and cellular aging. 100 vials, everything you need on the shelf day one.

Péptidos Incluidos

Qué Incluye Este Kit

10 péptidos, cada uno con documentación COA individual

BPC-157 10mg

BPC-157 10mg

$67.95

Tendon, ligament, and muscle repair biology · Gastrointestinal ulcer and IBD research · Neuroprotection and nerve regeneration

BPC-157 is a synthetic 15-amino acid fragment derived from human gastric body protection compound.

10mgHealing / Recovery
TB500 10mg

TB500 10mg

$99.95

Dermal wound-repair biology models · Cardiac injury and migration signaling research · Inflammatory pathway and remodeling studies

TB-500 (synthetic thymosin beta-4) is studied for its role in actin dynamics, a core process that helps cells migrate, reorganize, and respond to repair signals.

10mgHealing / Recovery
CJC-1295 5mg

CJC-1295 5mg

$47.95

Pulsatile GH release studies · Combination protocols with GHRPs (e.g., Ipamorelin) · Growth hormone axis assessment

Mod GRF 1-29 is a modified 29-amino acid fragment of GHRH with four amino acid substitutions that prevent enzymatic degradation: D-Ala2 prevents DPP-IV cleavage, Gln8 prevents asparagine rearrangement, Ala15 enhances bioactivity, and Leu27 prevents methionine oxidation.

5mgGrowth Hormone / GH Secretagogues
Ipamorelin 5mg

Ipamorelin 5mg

$40.95

Selective GH secretion without cortisol elevation · Synergistic combination with GHRH analogs · Bone density and growth studies

Ipamorelin is a highly selective growth hormone secretagogue that acts on the ghrelin/GHS receptor (GHSR) in the pituitary to stimulate pulsatile GH release.

5mgGrowth Hormone / GH Secretagogues
Semax 10mg

Semax 10mg

$37.95

Cognitive enhancement and memory consolidation · Stroke recovery and neuroprotection · BDNF and neurotrophin pathway upregulation

Semax is a synthetic heptapeptide analog of ACTH(4-10) with a stabilizing Pro-Gly-Pro extension.

10mgCognitive / Neuropeptides
Selank 10mg

Selank 10mg

$32.95

Anxiety reduction without sedation · Immune modulation via tuftsin pathway · Cognitive enhancement and memory

Selank is a synthetic heptapeptide derived from the immunomodulatory peptide tuftsin (Thr-Lys-Pro-Arg) with a C-terminal Pro-Gly-Pro extension that enhances metabolic stability.

10mgCognitive / Neuropeptides
Thymosin Alpha 1 5mg

Thymosin Alpha 1 5mg

$47.95

Hepatitis B and C treatment (approved in some countries) · oncology immunotherapy adjunct · Vaccine response enhancement

Thymosin Alpha 1 is a naturally occurring thymic peptide that acts as an immunomodulator by enhancing T-cell maturation, differentiation, and function.

5mgHealing / Recovery
LL37 5mg

LL37 5mg

$71.95

Antimicrobial defense against bacteria, fungi, and viruses · Wound repair biology and tissue regeneration · Innate immune system modulation

LL-37 is the only human cathelicidin antimicrobial peptide.

5mgHealing / Recovery
Epithalon 10mg

Epithalon 10mg

$23.95

Telomerase activation and telomere elongation · cellular aging and lifespan extension · Circadian rhythm and melatonin restoration

Epithalon is a synthetic tetrapeptide based on the natural epithalamin produced by the pineal gland.

10mgAnti-Aging / Longevity
NAD+ 500mg

NAD+ 500mg

$74.95

Age-related NAD+ decline and supplementation · Sirtuin biology and activation · DNA repair and genomic stability

NAD+ is an essential coenzyme present in all living cells that serves as an electron carrier in metabolic redox reactions (glycolysis, TCA cycle, oxidative phosphorylation) and as a substrate for NAD+-consuming enzymes including sirtuins (SIRT1-7), PARPs, and CD38.

500mgAnti-Aging / Longevity
Lectura por péptido

Profundiza en los péptidos dentro del kit

Selección de artículos ligada directamente a los compuestos de este kit, para que el investigador pase del bundle a la literatura, el mecanismo y el manejo específico de cada péptido.

Ver la biblioteca completa

Comienza tu Investigación

Get the complete Total Wellness Clinic Starter Kit at $1799.00 — save $-1252.50 versus purchasing each compound separately. Full COA documentation included with every vial.

Solo para Uso en Investigación. Estos kits están destinados únicamente para fines de investigación en laboratorio. No para consumo humano. Los resúmenes públicos reflejan literatura publicada y documentación analítica, no instrucciones de uso humano ni claims terapéuticos.