Earn 10 pts/$1 + 500 bonus points on signup|
Recovery & Performance Clinic Kit research kit - MiPeptidos
Recovery & Performance Clinic Kit Research Brief
Free download — literature summary PDF
Literature SummaryHPLC DataPMIDs + CitationsEN + ES

No spam. Unsubscribe anytime.

Analytical proof

Batch purity, right where researchers look for it.

Each included compound carries its own HPLC result, batch reference, and testing date so the research brief is backed by real analytical proof.

BPC-157 10mg

Purity (HPLC)

99.4%
HR-BPC1-2600215
RP-HPLC C18March 20, 2026

TB500 10mg

Purity (HPLC)

99.8%
HR-TB50-2600315
RP-HPLC C18March 28, 2026

CJC-1295 5mg

Purity (HPLC)

99.7%
HR-CJC1-2600315
RP-HPLC C18February 27, 2026

Ipamorelin 5mg

Purity (HPLC)

99.7%
HR-PMRL-2600215
RP-HPLC C18February 27, 2026

MK677 5mg

Purity (HPLC)

99.1%
HR-MK67-2600315
RP-HPLC C18January 21, 2026

IGF-1 LR3 1mg

Purity (HPLC)

99.5%
HR-GF1L-2600115
RP-HPLC C18March 5, 2026

PEG-MGF 2mg

Purity (HPLC)

99.8%
HR-PGMG-2600215
RP-HPLC C18February 24, 2026
Sports MedicineSave 17%

Recovery & Performance Clinic Kit

Stock your sports medicine or orthopedic clinic with 10 vials each of the 7 most-prescribed recovery and performance compounds

70 vials across 7 recovery compounds.

10x BPC-157 10mg — you pay $167.95, retail $229.50 (sell for $22.95/vial)
10x TB500 10mg — you pay $327.95, retail $449.50 (sell for $44.95/vial)
10x CJC-1295 5mg — you pay $167.95, retail $229.50 (sell for $22.95/vial)
10x Ipamorelin 5mg — you pay $101.95, retail $139.50 (sell for $13.95/vial)
Research Use Only.

Research Use Only. These kits are intended for laboratory research purposes only. Not for human consumption. Public-page summaries reflect published literature and analytical documentation, not human-use instructions or treatment claims.

Kit Bundle
$1,099.00
$398.75
Save -$700.25 (17% off)
BPC-157 10mg (10mg)
$74.95
TB500 10mg (10mg)
$58.95
CJC-1295 5mg (5mg)
$47.95
Ipamorelin 5mg (5mg)
$40.95
MK677 5mg (5mg)
$50.00
IGF-1 LR3 1mg (1mg)
$55.95
PEG-MGF 2mg (2mg)
$70.00
CoA Included
HPLC Verified
Same-Day Shipping
Third-Party Tested
Secured Transactions· 256-bit SSL
VISA
AMEX
DISC
Pay
Crypto
CoA Included
HPLC Verified
GMP Compliant
Third-Party Tested
Same-Day Shipping
Batch Tracked
Evidence snapshot

Built from published research, not guesswork.

Every public research kit now leads with the proof: cited studies, PMIDs, tracked signals, and batch-level documentation across each component.

Observation window
8 weeks
Study phases
Structured
Tracked endpoints
4
Publication span
Current literature
Featured studies
3
PMIDs on page
2
Research signals
4
COAs included
7
Compound architecture

What is inside the kit, structurally

Core chemistry details pulled from each included compound so the page feels like a real research profile, not a generic bundle card.

BPC-157 10mg

CAS: 137525-51-0

BPC-157 is a synthetic 15-amino acid fragment derived from human gastric body protection compound. It promotes angiogenesis by upregulating VEGF and its receptor VEGFR2, activates the FAK-paxillin pathway to enhance cell migration and wound closure, and modulates the nitric oxide system. It also interacts with the dopaminergic system and has cytoprotective effects on gastrointestinal mucosa, tendons, ligaments, and other connective tissues.

Molecular formula
C62H98N16O22
Molecular weight
1419.56 Da
Sequence
Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val (15 amino acids)

TB500 10mg

CAS: 77591-33-4 (Thymosin Beta-4); 885340-08-9 (synthetic TB-500 fragment)

TB-500 (synthetic thymosin beta-4) is studied for its role in actin dynamics, a core process that helps cells migrate, reorganize, and respond to repair signals. Published literature has examined its interaction with angiogenic signaling, inflammatory pathways, and tissue-remodeling biology across multiple preclinical models. The active region LKKTETQ is considered central to its actin-binding activity.

Molecular formula
C212H350N56O78S
Molecular weight
4963.44 Da (full Thymosin Beta-4)
Sequence
Full TB4: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETTIEQEKQAGES (43 amino acids); Active region: LKKTETQ (residues 17-23)

CJC-1295 5mg

CAS: 446036-97-1

Mod GRF 1-29 is a modified 29-amino acid fragment of GHRH with four amino acid substitutions that prevent enzymatic degradation: D-Ala2 prevents DPP-IV cleavage, Gln8 prevents asparagine rearrangement, Ala15 enhances bioactivity, and Leu27 prevents methionine oxidation. Without the DAC moiety, it produces more physiologic pulsatile GH release patterns, stimulating somatotrophs through GHRH receptors with a much shorter duration of action.

Molecular formula
C152H252N44O42
Molecular weight
3367.90 Da
Sequence
Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 (29 amino acids with D-Ala2, Gln8, Ala15, Leu27 substitutions)

Ipamorelin 5mg

CAS: 170851-70-4

Ipamorelin is a highly selective growth hormone secretagogue that acts on the ghrelin/GHS receptor (GHSR) in the pituitary to stimulate pulsatile GH release. Unlike other GHRPs, ipamorelin does not significantly affect cortisol, ACTH, or prolactin levels at GH-releasing doses, making it the most selective GHS available. It works synergistically with GHRH analogs (like CJC-1295) to amplify GH pulses while maintaining the natural pulsatile release pattern.

Molecular formula
C38H49N9O5
Molecular weight
711.85 Da
Sequence
Aib-His-D-2-Nal-D-Phe-Lys-NH2 (pentapeptide with non-natural amino acids)

MK677 5mg

CAS: 159634-47-6

MK-677 is an orally active, non-peptidic ghrelin receptor (GHSR-1a) agonist that mimics the GH-releasing activity of ghrelin. It stimulates pituitary GH release by binding to GHSR-1a, increasing GH pulse amplitude without altering pulse frequency. It also increases IGF-1 levels, promotes nitrogen retention, and stimulates appetite. Unlike peptide GH secretagogues, it is orally bioavailable and has a long duration of action, maintaining elevated GH and IGF-1 levels with once-daily dosing.

Molecular formula
C27H36N4O5S
Molecular weight
528.67 Da
Sequence
N/A (not a peptide; non-peptidic small molecule)

IGF-1 LR3 1mg

CAS: 946870-92-4

IGF-1 LR3 is a synthetic 83-amino acid analog of IGF-1 (which has 70 amino acids) with an arginine at position 3 and a 13-amino acid extension at the N-terminus. These modifications reduce binding to IGF binding proteins (IGFBPs) by over 100-fold, resulting in dramatically higher bioavailability and potency compared to native IGF-1. It activates the IGF-1 receptor to stimulate the PI3K/Akt and MAPK/ERK pathways, promoting cell proliferation, differentiation, survival, and protein synthesis in muscle and other tissues.

Molecular formula
C400H625N111O115S9
Molecular weight
9117.50 Da
Sequence
83-amino acid protein; modified IGF-1 with Arg substitution at position 3 and a 13-amino acid N-terminal extension peptide

PEG-MGF 2mg

CAS: Not formally assigned

PEG-MGF shares the same mechanism as MGF (satellite cell activation, muscle repair, neuroprotection) but has been modified through PEGylation, which involves covalent attachment of polyethylene glycol chains. This modification shields the peptide from enzymatic degradation, reduces renal clearance, and dramatically extends its half-life from minutes to hours. The sustained exposure allows for systemic distribution and more prolonged satellite cell activation.

Molecular formula
C121H200N42O39 (core peptide; PEG adds variable molecular weight)
Molecular weight
~5000-6000 Da (depending on PEG size)
Sequence
Same MGF 24-amino acid sequence (YQPPSTNKNTKSQRRKGSTFEEHK) with covalent polyethylene glycol modification
Why this kit exists

Why these compounds are paired in the literature

Plain-English summaries of the mechanisms and published pairings that make this kit coherent for real research work.

1
BPC-157 10mg

Stock your sports medicine or orthopedic clinic with 10 vials each of the 7 most-prescribed recovery and performance compounds. Sell each vial at retail and pocket $467+ per kit — a 30% margin before your tier discount.

Included Peptides

What's in This Kit

7 peptides, each with individual COA documentation

BPC-157 10mg

BPC-157 10mg

$74.95

Tendon, ligament, and muscle repair biology · Gastrointestinal ulcer and IBD research · Neuroprotection and nerve regeneration

BPC-157 is a synthetic 15-amino acid fragment derived from human gastric body protection compound.

10mgHealing / Recovery
TB500 10mg

TB500 10mg

$58.95

Dermal wound-repair biology models · Cardiac injury and migration signaling research · Inflammatory pathway and remodeling studies

TB-500 (synthetic thymosin beta-4) is studied for its role in actin dynamics, a core process that helps cells migrate, reorganize, and respond to repair signals.

10mgHealing / Recovery
CJC-1295 5mg

CJC-1295 5mg

$47.95

Pulsatile GH release studies · Combination protocols with GHRPs (e.g., Ipamorelin) · Growth hormone axis assessment

Mod GRF 1-29 is a modified 29-amino acid fragment of GHRH with four amino acid substitutions that prevent enzymatic degradation: D-Ala2 prevents DPP-IV cleavage, Gln8 prevents asparagine rearrangement, Ala15 enhances bioactivity, and Leu27 prevents methionine oxidation.

5mgGrowth Hormone / GH Secretagogues
Ipamorelin 5mg

Ipamorelin 5mg

$40.95

Selective GH secretion without cortisol elevation · Synergistic combination with GHRH analogs · Bone density and growth studies

Ipamorelin is a highly selective growth hormone secretagogue that acts on the ghrelin/GHS receptor (GHSR) in the pituitary to stimulate pulsatile GH release.

5mgGrowth Hormone / GH Secretagogues
MK677 5mg

MK677 5mg

$50.00

Oral GH secretagogue pharmacology · Muscle wasting and sarcopenia · Bone density improvement

MK-677 is an orally active, non-peptidic ghrelin receptor (GHSR-1a) agonist that mimics the GH-releasing activity of ghrelin.

5mgGrowth Hormone / GH Secretagogues
IGF-1 LR3 1mg

IGF-1 LR3 1mg

$55.95

muscle-signaling and hypertrophy beyond GH/IGF-1 axis · IGFBP-independent IGF-1 signaling · Cell proliferation and anti-apoptosis

IGF-1 LR3 is a synthetic 83-amino acid analog of IGF-1 (which has 70 amino acids) with an arginine at position 3 and a 13-amino acid extension at the N-terminus.

1mgGrowth Hormone / GH Secretagogues
PEG-MGF 2mg

PEG-MGF 2mg

$70.00

Extended-release muscle repair studies · PEGylation pharmacokinetic optimization · Systemic vs. local MGF effects

PEG-MGF shares the same mechanism as MGF (satellite cell activation, muscle repair, neuroprotection) but has been modified through PEGylation, which involves covalent attachment of polyethylene glycol chains.

2mgGrowth Hormone / GH Secretagogues
Peptide reading

Go deeper on the peptides inside the kit

Article picks tied directly to the compounds in this kit, so researchers can move from the bundle view into peptide-specific literature, mechanism, and handling context.

Browse the full research library

Start Your Research

Get the complete Recovery & Performance Clinic Kit at $1099.00 — save $-700.25 versus purchasing each compound separately. Full COA documentation included with every vial.

Research Use Only. These kits are intended for laboratory research purposes only. Not for human consumption. Public-page summaries reflect published literature and analytical documentation, not human-use instructions or treatment claims.