Gana 10 pts/$1 + 500 puntos de bonificación al registrarte|
Recovery & Performance Clinic Kit research kit - MiPeptidos
Resumen de Investigación de Recovery & Performance Clinic Kit
Descarga gratuita — resumen bibliográfico en PDF
Resumen bibliográficoDatos HPLCPMIDs + citasEN + ES

Sin spam. Cancela en cualquier momento.

Prueba analítica

Pureza por lote, justo donde los investigadores la buscan.

Cada compuesto incluido muestra su resultado HPLC, referencia de lote y fecha de prueba para que el research brief esté respaldado por evidencia analítica real.

BPC-157 10mg

Pureza (HPLC)

99.4%
HR-BPC1-2600215
RP-HPLC C18March 20, 2026

TB500 10mg

Pureza (HPLC)

99.8%
HR-TB50-2600315
RP-HPLC C18March 28, 2026

CJC-1295 5mg

Pureza (HPLC)

99.7%
HR-CJC1-2600315
RP-HPLC C18February 27, 2026

Ipamorelin 5mg

Pureza (HPLC)

99.7%
HR-PMRL-2600215
RP-HPLC C18February 27, 2026

MK677 5mg

Pureza (HPLC)

99.1%
HR-MK67-2600315
RP-HPLC C18January 21, 2026

IGF-1 LR3 1mg

Pureza (HPLC)

99.5%
HR-GF1L-2600115
RP-HPLC C18March 5, 2026

PEG-MGF 2mg

Pureza (HPLC)

99.8%
HR-PGMG-2600215
RP-HPLC C18February 24, 2026
Investigacion en RecuperacionSave 17%

Recovery & Performance Clinic Kit

Stock your sports medicine or orthopedic clinic with 10 vials each of the 7 most-prescribed recovery and performance compounds

Siete peptidos que abarcan reparacion tisular, optimizacion de hormona de crecimiento y vias de senalizacion de crecimiento muscular — la plataforma completa de investigacion enfocada en recuperacion para instalaciones clinicas.

10x BPC-157 10mg — you pay $167.95, retail $229.50 (sell for $22.95/vial)
10x TB500 10mg — you pay $327.95, retail $449.50 (sell for $44.95/vial)
10x CJC-1295 5mg — you pay $167.95, retail $229.50 (sell for $22.95/vial)
10x Ipamorelin 5mg — you pay $101.95, retail $139.50 (sell for $13.95/vial)
Solo para Uso en Investigación.

Solo para Uso en Investigación. Estos kits están destinados únicamente para fines de investigación en laboratorio. No para consumo humano. Los resúmenes públicos reflejan literatura publicada y documentación analítica, no instrucciones de uso humano ni claims terapéuticos.

Paquete de Kit
USD 1,099.00
USD 432.75
Ahorra -USD 666.25 (17% off)
BPC-157 10mg (10mg)
USD 67.95
TB500 10mg (10mg)
USD 99.95
CJC-1295 5mg (5mg)
USD 47.95
Ipamorelin 5mg (5mg)
USD 40.95
MK677 5mg (5mg)
USD 50.00
IGF-1 LR3 1mg (1mg)
USD 55.95
PEG-MGF 2mg (2mg)
USD 70.00
COA Incluido
Verificado por HPLC
Envío el Mismo Día
Pruebas de Terceros
Transacciones Seguras· SSL de 256 bits
VISA
AMEX
DISC
Pay
Crypto
COA Incluido
Verificado por HPLC
Cumple con GMP
Pruebas de Terceros
Envío el Mismo Día
Lote Rastreado
Resumen de evidencia

Construido desde investigación publicada, no desde suposiciones.

Cada kit público ahora abre con la prueba: estudios citados, PMIDs, señales rastreadas y documentación por lote en cada componente.

Ventana de observación
8 semanas
Fases de estudio
Estructurado
Endpoints rastreados
4
Rango de publicación
Literatura actual
Estudios destacados
3
PMIDs en página
2
Señales de investigación
4
COAs incluidos
7
Arquitectura del compuesto

Qué hay dentro del kit, a nivel estructural

Detalles químicos clave tomados de cada compuesto incluido para que la página se sienta como un perfil de investigación real, no como una tarjeta genérica de bundle.

BPC-157 10mg

CAS: 137525-51-0

BPC-157 is a synthetic 15-amino acid fragment derived from human gastric body protection compound. It promotes angiogenesis by upregulating VEGF and its receptor VEGFR2, activates the FAK-paxillin pathway to enhance cell migration and wound closure, and modulates the nitric oxide system. It also interacts with the dopaminergic system and has cytoprotective effects on gastrointestinal mucosa, tendons, ligaments, and other connective tissues.

Fórmula molecular
C62H98N16O22
Peso molecular
1419.56 Da
Secuencia
Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val (15 amino acids)

TB500 10mg

CAS: 77591-33-4 (Thymosin Beta-4); 885340-08-9 (synthetic TB-500 fragment)

TB-500 (synthetic thymosin beta-4) is studied for its role in actin dynamics, a core process that helps cells migrate, reorganize, and respond to repair signals. Published literature has examined its interaction with angiogenic signaling, inflammatory pathways, and tissue-remodeling biology across multiple preclinical models. The active region LKKTETQ is considered central to its actin-binding activity.

Fórmula molecular
C212H350N56O78S
Peso molecular
4963.44 Da (full Thymosin Beta-4)
Secuencia
Full TB4: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETTIEQEKQAGES (43 amino acids); Active region: LKKTETQ (residues 17-23)

CJC-1295 5mg

CAS: 446036-97-1

Mod GRF 1-29 is a modified 29-amino acid fragment of GHRH with four amino acid substitutions that prevent enzymatic degradation: D-Ala2 prevents DPP-IV cleavage, Gln8 prevents asparagine rearrangement, Ala15 enhances bioactivity, and Leu27 prevents methionine oxidation. Without the DAC moiety, it produces more physiologic pulsatile GH release patterns, stimulating somatotrophs through GHRH receptors with a much shorter duration of action.

Fórmula molecular
C152H252N44O42
Peso molecular
3367.90 Da
Secuencia
Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 (29 amino acids with D-Ala2, Gln8, Ala15, Leu27 substitutions)

Ipamorelin 5mg

CAS: 170851-70-4

Ipamorelin is a highly selective growth hormone secretagogue that acts on the ghrelin/GHS receptor (GHSR) in the pituitary to stimulate pulsatile GH release. Unlike other GHRPs, ipamorelin does not significantly affect cortisol, ACTH, or prolactin levels at GH-releasing doses, making it the most selective GHS available. It works synergistically with GHRH analogs (like CJC-1295) to amplify GH pulses while maintaining the natural pulsatile release pattern.

Fórmula molecular
C38H49N9O5
Peso molecular
711.85 Da
Secuencia
Aib-His-D-2-Nal-D-Phe-Lys-NH2 (pentapeptide with non-natural amino acids)

MK677 5mg

CAS: 159634-47-6

MK-677 is an orally active, non-peptidic ghrelin receptor (GHSR-1a) agonist that mimics the GH-releasing activity of ghrelin. It stimulates pituitary GH release by binding to GHSR-1a, increasing GH pulse amplitude without altering pulse frequency. It also increases IGF-1 levels, promotes nitrogen retention, and stimulates appetite. Unlike peptide GH secretagogues, it is orally bioavailable and has a long duration of action, maintaining elevated GH and IGF-1 levels with once-daily dosing.

Fórmula molecular
C27H36N4O5S
Peso molecular
528.67 Da
Secuencia
N/A (not a peptide; non-peptidic small molecule)

IGF-1 LR3 1mg

CAS: 946870-92-4

IGF-1 LR3 is a synthetic 83-amino acid analog of IGF-1 (which has 70 amino acids) with an arginine at position 3 and a 13-amino acid extension at the N-terminus. These modifications reduce binding to IGF binding proteins (IGFBPs) by over 100-fold, resulting in dramatically higher bioavailability and potency compared to native IGF-1. It activates the IGF-1 receptor to stimulate the PI3K/Akt and MAPK/ERK pathways, promoting cell proliferation, differentiation, survival, and protein synthesis in muscle and other tissues.

Fórmula molecular
C400H625N111O115S9
Peso molecular
9117.50 Da
Secuencia
83-amino acid protein; modified IGF-1 with Arg substitution at position 3 and a 13-amino acid N-terminal extension peptide

PEG-MGF 2mg

CAS: Not formally assigned

PEG-MGF shares the same mechanism as MGF (satellite cell activation, muscle repair, neuroprotection) but has been modified through PEGylation, which involves covalent attachment of polyethylene glycol chains. This modification shields the peptide from enzymatic degradation, reduces renal clearance, and dramatically extends its half-life from minutes to hours. The sustained exposure allows for systemic distribution and more prolonged satellite cell activation.

Fórmula molecular
C121H200N42O39 (core peptide; PEG adds variable molecular weight)
Peso molecular
~5000-6000 Da (depending on PEG size)
Secuencia
Same MGF 24-amino acid sequence (YQPPSTNKNTKSQRRKGSTFEEHK) with covalent polyethylene glycol modification
Por qué existe este kit

Por qué estos compuestos se combinan en la literatura

Resúmenes en lenguaje claro de los mecanismos y combinaciones publicadas que hacen que este kit tenga sentido para investigación real.

1
BPC-157 10mg

Stock your sports medicine or orthopedic clinic with 10 vials each of the 7 most-prescribed recovery and performance compounds. Sell each vial at retail and pocket $467+ per kit — a 30% margin before your tier discount.

Péptidos Incluidos

Qué Incluye Este Kit

7 péptidos, cada uno con documentación COA individual

BPC-157 10mg

BPC-157 10mg

$67.95

Tendon, ligament, and muscle repair biology · Gastrointestinal ulcer and IBD research · Neuroprotection and nerve regeneration

BPC-157 is a synthetic 15-amino acid fragment derived from human gastric body protection compound.

10mgHealing / Recovery
TB500 10mg

TB500 10mg

$99.95

Dermal wound-repair biology models · Cardiac injury and migration signaling research · Inflammatory pathway and remodeling studies

TB-500 (synthetic thymosin beta-4) is studied for its role in actin dynamics, a core process that helps cells migrate, reorganize, and respond to repair signals.

10mgHealing / Recovery
CJC-1295 5mg

CJC-1295 5mg

$47.95

Pulsatile GH release studies · Combination protocols with GHRPs (e.g., Ipamorelin) · Growth hormone axis assessment

Mod GRF 1-29 is a modified 29-amino acid fragment of GHRH with four amino acid substitutions that prevent enzymatic degradation: D-Ala2 prevents DPP-IV cleavage, Gln8 prevents asparagine rearrangement, Ala15 enhances bioactivity, and Leu27 prevents methionine oxidation.

5mgGrowth Hormone / GH Secretagogues
Ipamorelin 5mg

Ipamorelin 5mg

$40.95

Selective GH secretion without cortisol elevation · Synergistic combination with GHRH analogs · Bone density and growth studies

Ipamorelin is a highly selective growth hormone secretagogue that acts on the ghrelin/GHS receptor (GHSR) in the pituitary to stimulate pulsatile GH release.

5mgGrowth Hormone / GH Secretagogues
MK677 5mg

MK677 5mg

$50.00

Oral GH secretagogue pharmacology · Muscle wasting and sarcopenia · Bone density improvement

MK-677 is an orally active, non-peptidic ghrelin receptor (GHSR-1a) agonist that mimics the GH-releasing activity of ghrelin.

5mgGrowth Hormone / GH Secretagogues
IGF-1 LR3 1mg

IGF-1 LR3 1mg

$55.95

muscle-signaling and hypertrophy beyond GH/IGF-1 axis · IGFBP-independent IGF-1 signaling · Cell proliferation and anti-apoptosis

IGF-1 LR3 is a synthetic 83-amino acid analog of IGF-1 (which has 70 amino acids) with an arginine at position 3 and a 13-amino acid extension at the N-terminus.

1mgGrowth Hormone / GH Secretagogues
PEG-MGF 2mg

PEG-MGF 2mg

$70.00

Extended-release muscle repair studies · PEGylation pharmacokinetic optimization · Systemic vs. local MGF effects

PEG-MGF shares the same mechanism as MGF (satellite cell activation, muscle repair, neuroprotection) but has been modified through PEGylation, which involves covalent attachment of polyethylene glycol chains.

2mgGrowth Hormone / GH Secretagogues
Lectura por péptido

Profundiza en los péptidos dentro del kit

Selección de artículos ligada directamente a los compuestos de este kit, para que el investigador pase del bundle a la literatura, el mecanismo y el manejo específico de cada péptido.

Ver la biblioteca completa

Comienza tu Investigación

Get the complete Recovery & Performance Clinic Kit at $1099.00 — save $-666.25 versus purchasing each compound separately. Full COA documentation included with every vial.

Solo para Uso en Investigación. Estos kits están destinados únicamente para fines de investigación en laboratorio. No para consumo humano. Los resúmenes públicos reflejan literatura publicada y documentación analítica, no instrucciones de uso humano ni claims terapéuticos.