Earn 10 pts/$1 + 500 bonus points on signup|
Researcher Starter Kit research kit - MiPeptidos
Researcher Starter Kit Research Brief
Free download — literature summary PDF
Literature SummaryHPLC DataPMIDs + CitationsEN + ES

No spam. Unsubscribe anytime.

Analytical proof

Batch purity, right where researchers look for it.

Each included compound carries its own HPLC result, batch reference, and testing date so the research brief is backed by real analytical proof.

BPC 157

Purity (HPLC)

99.4%
HR-BPC1-2600215
RP-HPLC C18March 20, 2026

TB500

Purity (HPLC)

99.8%
HR-TB50-2600315
RP-HPLC C18March 28, 2026

Bacteriostatic Water

Purity (HPLC)

99.4%
HR-BCTR-2600315
RP-HPLC C18January 12, 2026
BeginnerSave 10%

Researcher Starter Kit

Designed as the cleanest starting point for researchers entering peptide work

An entry-point research kit built around BPC-157, TB500, and the reconstitution support needed to begin comparative study.

Entry-point kit with two widely recognized repair compounds
Includes bacteriostatic water so the setup is complete from the start
Smaller sizes make it easier to begin comparative research without overbuying
Built around one of the most familiar pairings in repair literature
Research Use Only.

Research Use Only. These kits are intended for laboratory research purposes only. Not for human consumption. Public-page summaries reflect published literature and analytical documentation, not human-use instructions or treatment claims.

Kit Bundle
$90.81
$100.90
Save $10.09 (10% off)
BPC 157 (5mg)
$49.95
TB500 (5mg)
$38.95
Bacteriostatic Water (10ml)
$12.00
CoA Included
HPLC Verified
Same-Day Shipping
Third-Party Tested
Secured Transactions· 256-bit SSL
VISA
AMEX
DISC
Pay
Crypto
CoA Included
HPLC Verified
GMP Compliant
Third-Party Tested
Same-Day Shipping
Batch Tracked
Evidence snapshot

Built from published research, not guesswork.

Every public research kit now leads with the proof: cited studies, PMIDs, tracked signals, and batch-level documentation across each component.

Observation window
8 weeks
Study phases
Structured
Tracked endpoints
4
Publication span
Current literature
Featured studies
3
PMIDs on page
2
Research signals
4
COAs included
3
Compound architecture

What is inside the kit, structurally

Core chemistry details pulled from each included compound so the page feels like a real research profile, not a generic bundle card.

BPC 157

CAS: 137525-51-0

BPC-157 is a synthetic 15-amino acid fragment derived from human gastric body protection compound. It promotes angiogenesis by upregulating VEGF and its receptor VEGFR2, activates the FAK-paxillin pathway to enhance cell migration and wound closure, and modulates the nitric oxide system. It also interacts with the dopaminergic system and has cytoprotective effects on gastrointestinal mucosa, tendons, ligaments, and other connective tissues.

Molecular formula
C62H98N16O22
Molecular weight
1419.56 Da
Sequence
Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val (15 amino acids)

TB500

CAS: 77591-33-4 (Thymosin Beta-4); 885340-08-9 (synthetic TB-500 fragment)

TB-500 (synthetic thymosin beta-4) is studied for its role in actin dynamics, a core process that helps cells migrate, reorganize, and respond to repair signals. Published literature has examined its interaction with angiogenic signaling, inflammatory pathways, and tissue-remodeling biology across multiple preclinical models. The active region LKKTETQ is considered central to its actin-binding activity.

Molecular formula
C212H350N56O78S
Molecular weight
4963.44 Da (full Thymosin Beta-4)
Sequence
Full TB4: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETTIEQEKQAGES (43 amino acids); Active region: LKKTETQ (residues 17-23)

Bacteriostatic Water

CAS: 7732-18-5 (water); contains 0.9% benzyl alcohol (CAS 100-51-6) as preservative

Bacteriostatic water is sterile water for injection containing 0.9% benzyl alcohol as a bacteriostatic preservative. The benzyl alcohol inhibits bacterial growth, allowing the vial to be used for multiple reconstitutions over an extended period. It is used as a diluent for reconstituting lyophilized peptides and medications. The benzyl alcohol disrupts bacterial cell membrane integrity and interferes with microbial metabolic processes, preventing contamination of multi-use vials.

Molecular formula
H2O (with 0.9% C7H8O benzyl alcohol)
Molecular weight
18.02 Da (water)
Sequence
N/A (not a peptide; sterile diluent)

Published study parameters

Typical dose ranges, intervals, and administration routes cited in the literature for the compounds in this kit.

Research Protocol Notes

Standard reconstitution protocols call for 2ml of bacteriostatic water per vial. Doses are drawn with an insulin syringe. Reconstituted peptides are stored refrigerated per stability data. BPC-157 is most commonly administered near the injury site. Both peptides can be combined in the same syringe.

BPC 157

Morning, fasted
Dose ranges cited
250mcg
Intervals cited
1-2x daily
Routes cited
Subcutaneous at studied administration sites

TB500

reported study windows
Dose ranges cited
2mg
Intervals cited
2x per week
Routes cited
Subcutaneous

Bacteriostatic Water

Prior to first use
Dose ranges cited
2ml per vial
Intervals cited
For reconstitution
Routes cited
Reconstitution

These are publication-style study parameters summarized from cited literature and investigational designs. They are provided as research context only, not as human-use instructions or recommendations.

Why this kit exists

Why these compounds are paired in the literature

Plain-English summaries of the mechanisms and published pairings that make this kit coherent for real research work.

1
BPC 157

BPC-157 is the most widely researched repair biology peptide in published literature, with studies demonstrating effects on gut mucosal integrity, joint repair-signaling research, and inflammatory modulation (PMID: 29356623).

2
TB500

TB500 (Thymosin Beta-4) is shown in research to complement BPC-157 through cellular migration and inflammatory-pathway mechanisms — making them the most frequently co-studied peptide pairing in repair-signaling research literature (PMID: 20816543).

3
Bacteriostatic Water

Bacteriostatic water is included as the standard diluent for peptide reconstitution — no separate purchase needed to begin research immediately.

Peptide reading

Go deeper on the peptides inside the kit

Article picks tied directly to the compounds in this kit, so researchers can move from the bundle view into peptide-specific literature, mechanism, and handling context.

Browse the full research library

Start Your Research

Get the complete Researcher Starter Kit at $90.81 — save $10.09 versus purchasing each compound separately. Full COA documentation included with every vial.

Research Use Only. These kits are intended for laboratory research purposes only. Not for human consumption. Public-page summaries reflect published literature and analytical documentation, not human-use instructions or treatment claims.