Earn 10 pts/$1 + 500 bonus points on signup|
Top Sellers Mega Pack research kit - MiPeptidos
Top Sellers Mega Pack Research Brief
Free download — literature summary PDF
Literature SummaryHPLC DataPMIDs + CitationsEN + ES

No spam. Unsubscribe anytime.

Analytical proof

Batch purity, right where researchers look for it.

Each included compound carries its own HPLC result, batch reference, and testing date so the research brief is backed by real analytical proof.

BPC-157 10mg

Purity (HPLC)

99.4%
HR-BPC1-2600215
RP-HPLC C18March 20, 2026

TB500 10mg

Purity (HPLC)

99.8%
HR-TB50-2600315
RP-HPLC C18March 28, 2026

Semaglutide 10mg

Purity (HPLC)

99.1%
HR-SMGL-2600315
RP-HPLC C18January 21, 2026

Tirzepatide 10mg

Purity (HPLC)

99.2%
HR-TRZP-2600315
RP-HPLC C18January 2, 2026

Ipamorelin 5mg

Purity (HPLC)

99.7%
HR-PMRL-2600215
RP-HPLC C18February 27, 2026
Best SellersSave 20%

Top Sellers Mega Pack

Our 5 highest-volume peptides in 20-packs each

100 vials of the 5 top sellers at 20-pack pricing.

20x BPC-157 10mg — fastest mover in repair-signaling research
20x TB500 10mg — #2 seller, pairs with BPC-157
20x Semaglutide 10mg — GLP-1 leader, highest patient demand
20x Tirzepatide 10mg — dual agonist, growing fast
Research Use Only.

Research Use Only. These kits are intended for laboratory research purposes only. Not for human consumption. Public-page summaries reflect published literature and analytical documentation, not human-use instructions or treatment claims.

Kit Bundle
$4,999.00
$520.75
Save -$4,478.25 (20% off)
BPC-157 10mg (10mg)
$67.95
TB500 10mg (10mg)
$99.95
Semaglutide 10mg (10mg)
$86.95
Tirzepatide 10mg (10mg)
$224.95
Ipamorelin 5mg (5mg)
$40.95
CoA Included
HPLC Verified
Same-Day Shipping
Third-Party Tested
Secured Transactions· 256-bit SSL
VISA
AMEX
DISC
Pay
Crypto
CoA Included
HPLC Verified
GMP Compliant
Third-Party Tested
Same-Day Shipping
Batch Tracked
Evidence snapshot

Built from published research, not guesswork.

Every public research kit now leads with the proof: cited studies, PMIDs, tracked signals, and batch-level documentation across each component.

Observation window
8 weeks
Study phases
Structured
Tracked endpoints
4
Publication span
Current literature
Featured studies
3
PMIDs on page
2
Research signals
4
COAs included
5
Compound architecture

What is inside the kit, structurally

Core chemistry details pulled from each included compound so the page feels like a real research profile, not a generic bundle card.

BPC-157 10mg

CAS: 137525-51-0

BPC-157 is a synthetic 15-amino acid fragment derived from human gastric body protection compound. It promotes angiogenesis by upregulating VEGF and its receptor VEGFR2, activates the FAK-paxillin pathway to enhance cell migration and wound closure, and modulates the nitric oxide system. It also interacts with the dopaminergic system and has cytoprotective effects on gastrointestinal mucosa, tendons, ligaments, and other connective tissues.

Molecular formula
C62H98N16O22
Molecular weight
1419.56 Da
Sequence
Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val (15 amino acids)

TB500 10mg

CAS: 77591-33-4 (Thymosin Beta-4); 885340-08-9 (synthetic TB-500 fragment)

TB-500 (synthetic thymosin beta-4) is studied for its role in actin dynamics, a core process that helps cells migrate, reorganize, and respond to repair signals. Published literature has examined its interaction with angiogenic signaling, inflammatory pathways, and tissue-remodeling biology across multiple preclinical models. The active region LKKTETQ is considered central to its actin-binding activity.

Molecular formula
C212H350N56O78S
Molecular weight
4963.44 Da (full Thymosin Beta-4)
Sequence
Full TB4: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETTIEQEKQAGES (43 amino acids); Active region: LKKTETQ (residues 17-23)

Semaglutide 10mg

CAS: 910463-68-2

Semaglutide is a GLP-1 receptor agonist that mimics native GLP-1 to stimulate insulin secretion in a glucose-dependent manner while suppressing glucagon release. The Aib substitution at position 2 confers resistance to DPP-IV enzymatic degradation, and the C18 fatty diacid chain enables high-affinity albumin binding, extending its half-life substantially. It also acts on hypothalamic appetite centers to reduce food intake and delay gastric emptying.

Molecular formula
C187H291N45O59
Molecular weight
4113.64 Da
Sequence
Modified GLP-1(7-37) analog; 31 amino acids with Aib at position 8, Arg at position 34, and a C18 fatty diacid chain via linker at Lys26

Tirzepatide 10mg

CAS: 2023788-19-2

Tirzepatide is a dual GIP and GLP-1 receptor agonist that activates both incretin pathways simultaneously. It stimulates insulin secretion, suppresses glucagon in a glucose-dependent manner, and reduces appetite via central and peripheral signaling. The dual receptor engagement provides synergistic metabolic effects beyond GLP-1 agonism alone, including enhanced lipid metabolism and improved insulin sensitivity.

Molecular formula
C225H348N48O68
Molecular weight
4813.45 Da
Sequence
39-amino acid peptide based on GIP sequence with Aib at positions 2 and 13, and a C20 fatty diacid chain conjugated to Lys20 via a linker; C-terminal amidation

Ipamorelin 5mg

CAS: 170851-70-4

Ipamorelin is a highly selective growth hormone secretagogue that acts on the ghrelin/GHS receptor (GHSR) in the pituitary to stimulate pulsatile GH release. Unlike other GHRPs, ipamorelin does not significantly affect cortisol, ACTH, or prolactin levels at GH-releasing doses, making it the most selective GHS available. It works synergistically with GHRH analogs (like CJC-1295) to amplify GH pulses while maintaining the natural pulsatile release pattern.

Molecular formula
C38H49N9O5
Molecular weight
711.85 Da
Sequence
Aib-His-D-2-Nal-D-Phe-Lys-NH2 (pentapeptide with non-natural amino acids)
Why this kit exists

Why these compounds are paired in the literature

Plain-English summaries of the mechanisms and published pairings that make this kit coherent for real research work.

1
BPC-157 10mg

Our 5 highest-volume peptides in 20-packs each. BPC-157, TB500, Semaglutide, Tirzepatide, and Ipamorelin — the compounds every clinic moves the most of. Double inventory depth at the best per-vial cost we offer.

Included Peptides

What's in This Kit

5 peptides, each with individual COA documentation

BPC-157 10mg

BPC-157 10mg

$67.95

Tendon, ligament, and muscle repair biology · Gastrointestinal ulcer and IBD research · Neuroprotection and nerve regeneration

BPC-157 is a synthetic 15-amino acid fragment derived from human gastric body protection compound.

10mgHealing / Recovery
TB500 10mg

TB500 10mg

$99.95

Dermal wound-repair biology models · Cardiac injury and migration signaling research · Inflammatory pathway and remodeling studies

TB-500 (synthetic thymosin beta-4) is studied for its role in actin dynamics, a core process that helps cells migrate, reorganize, and respond to repair signals.

10mgHealing / Recovery
Semaglutide 10mg

Semaglutide 10mg

$86.95

glucose-regulation research glucose-regulation research · energy-balance research and metabolic signaling research · cardiometabolic research in diabetic populations

Semaglutide is a GLP-1 receptor agonist that mimics native GLP-1 to stimulate insulin secretion in a glucose-dependent manner while suppressing glucagon release.

10mgGLP-1 / Weight Management
Tirzepatide 10mg

Tirzepatide 10mg

$224.95

glucose-regulation research with superior HbA1c reduction · energy-balance research treatment with significant metabolic research outcomes · Dual incretin receptor pharmacology studies

Tirzepatide is a dual GIP and GLP-1 receptor agonist that activates both incretin pathways simultaneously.

10mgGLP-1 / Weight Management
Ipamorelin 5mg

Ipamorelin 5mg

$40.95

Selective GH secretion without cortisol elevation · Synergistic combination with GHRH analogs · Bone density and growth studies

Ipamorelin is a highly selective growth hormone secretagogue that acts on the ghrelin/GHS receptor (GHSR) in the pituitary to stimulate pulsatile GH release.

5mgGrowth Hormone / GH Secretagogues
Peptide reading

Go deeper on the peptides inside the kit

Article picks tied directly to the compounds in this kit, so researchers can move from the bundle view into peptide-specific literature, mechanism, and handling context.

Browse the full research library

Start Your Research

Get the complete Top Sellers Mega Pack at $4999.00 — save $-4478.25 versus purchasing each compound separately. Full COA documentation included with every vial.

Research Use Only. These kits are intended for laboratory research purposes only. Not for human consumption. Public-page summaries reflect published literature and analytical documentation, not human-use instructions or treatment claims.