PNC-27 - Front - MiPeptidos
Specialty / Research

PNC-27

CAS: 1159861-00-3

PNC-27 is a research peptide in the specialty / research category. PNC-27 is a 32-amino acid chimeric anticancer peptide consisting of two functional domains: residues from the HDM-2 (human double minute 2) binding domain of p53 (PPLSQETFSDLWKLL), and a membrane residency peptide (MRP) from the Antennapedia homeodomain (KKWKMRRNQFWVKVQRG). MiPeptidos offers PNC-27 in 1 sizes with 99.4% verified purity and full analytical documentation.

Starting at
$37.95/vial
In Stock
Ships same day
Request Quote
≥99% Purity
COA Included
Third-Party Tested
Same-Day Shipping
CoA Included
HPLC Verified
GMP Compliant
Third-Party Tested
Same-Day Shipping
Batch Tracked

How PNC-27 Works

PNC-27 is a 32-amino acid chimeric anticancer peptide consisting of two functional domains: residues from the HDM-2 (human double minute 2) binding domain of p53 (PPLSQETFSDLWKLL), and a membrane residency peptide (MRP) from the Antennapedia homeodomain (KKWKMRRNQFWVKVQRG). PNC-27 selectively binds to HDM-2 protein that is overexpressed in the plasma membrane of cancer cells (but not normal cells), causing membrane destabilization and rapid necrotic cell death. Normal cells, which express HDM-2 intranuclearly rather than on the cell surface, are unaffected.

Research Applications

1
Selective anticancer peptide therapy
2
HDM-2/MDM2 membrane biology in cancer
3
Tumor-selective membrane disruption
4
p53 pathway and cancer cell death
5
Peptide-based oncology therapeutics
View Published Research on PubMed →

Pricing

SizePer Vial10-Pack
5mg
$37.95$276.95

Prices shown per vial from 10-pack. Volume discounts available for 50+ vials — contact us.

HPLC Purity Analysis

High-Performance Liquid Chromatography
99.4%purity
mAURetention Time (min)0250500750100005101520253099.4%
Method: RP-HPLC C18 ColumnDetection: UV 220nmMobile Phase: Acetonitrile/Water + 0.1% TFA

Certificate of Analysis

MiPeptidos
PNC-27
PASSES ALL SPECIFICATIONS
Batch NumberHR-PNC2-2600115
Date of AnalysisMarch 20, 2026
Purity (HPLC)99.4%
AppearanceWhite to off-white lyophilized powder
SolubilityFreely soluble in sterile water and bacteriostatic water
Molecular Weight (MS)4031.72 Da — Confirmed
Endotoxin (LAL)<0.1 EU/mg
Sterility (USP <71>)Passes USP <71>

This COA is a representative sample. A batch-specific Certificate of Analysis with full HPLC chromatograms and mass spectrometry data is included with every MiPeptidos order.

Reconstitution Calculator

Add this much bacteriostatic water:
5.0 mL
5 mg PNC-27 + 5.0 mL BAC water = 1 mg/mL

Inject bacteriostatic water slowly along the vial wall. Gently swirl until dissolved — never shake. Store reconstituted solution at 2-8°C and use within 30 days.

Download Product Brochure

Get our detailed PNC-27 product brochure with specifications, research applications, HPLC analysis data, and reconstitution guide. Available in English and Spanish.

Customer Reviews

4.0/5from 1 review
Verified
Dr. Mei-Ling Wu·Taipei, Taiwan

PNC-27 is our p53-derived peptide targeting HDM2 for cancer cell selectivity studies. The chimeric peptide from MiPeptidos shows expected selective toxicity against HDM2-overexpressing cell lines in our assays. Four star...

Dec 20, 2025
View All Reviews →

Frequently Asked Questions

PNC-27 (CAS: 1159861-00-3) is a research compound, with a molecular weight of 4031.72 Da in the Specialty / Research category. PNC-27 is a 32-amino acid chimeric anticancer peptide consisting of two functional domains: residues from the HDM-2 (human double minute 2) binding domain of p53 (PPLSQETFSDLWKLL), and a membrane residency peptide (MRP) from the Antennapedia homeodomain (KKWKMRRNQFWVKVQRG). PNC-27 selectively binds to HDM-2 protein that is overexpressed in the plasma membrane of cancer cells (but not normal cells), causing membrane destabilization and rapid necrotic cell death. Researchers commonly investigate PNC-27 for Selective anticancer peptide therapy, HDM-2/MDM2 membrane biology in cancer, Tumor-selective membrane disruption. Every vial from MiPeptidos includes batch-specific analytical documentation.
To reconstitute your PNC-27 5mg vial, let it reach room temperature for about 15-20 minutes out of the freezer. Slowly inject 1-2mL of bacteriostatic water along the inside wall of the vial — never aim directly at the peptide cake. Gently swirl until the powder fully dissolves; never shake, as this can denature the peptide. Store reconstituted PNC-27 at 2-8°C and use within 30 days. MiPeptidos includes bacteriostatic water for purchase alongside all peptides.
PNC-27 represents a fundamentally different approach to cancer cell targeting than traditional chemotherapy. It is a 32-amino acid chimeric peptide with a p53-derived HDM-2 binding domain fused to a membrane-disrupting Antennapedia sequence. It selectively kills cancer cells that express HDM-2 on their plasma membrane while leaving normal cells (which keep HDM-2 nuclear) completely unaffected. This membrane-surface HDM-2 targeting is unique to PNC-27. MiPeptidos offers this at 99.4% purity for oncology research.
Store lyophilized PNC-27 at -20°C for maximum long-term stability — properly stored, it remains potent for 24+ months. Once reconstituted with bacteriostatic water, keep it refrigerated at 2-8°C and use within 30 days. In research applications, PNC-27 has a reported half-life of Not well characterized; research-stage compound, which informs dosing frequency and protocol design. Avoid repeated freeze-thaw cycles and protect from direct light. MiPeptidos ships every order with cold-chain packaging to maintain integrity during transit.
Every PNC-27 order from MiPeptidos includes a batch-specific Certificate of Analysis. Our current batch (HR-PNC2-2600115, tested March 20, 2026) shows 99.4% purity by HPLC, mass spectrometry confirmation at 4031.72 Da, endotoxin levels below 0.1 EU/mg, and passing sterility per USP <71>. This level of documentation ensures you can verify compound identity and purity before beginning your research. MiPeptidos also offers bulk pricing on orders of 50+ vials — contact info@mipeptidos.com.

Specifications

Purity
≥99%
Form
Lyophilized Powder
CAS Number
1159861-00-3
Mol. Weight
4031.72 Da
Formula
C188H293N53O44S
Half-Life
Not well characterized; research-stage compound
Storage
Store at -20°C. Reconstituted: 2–8°C for up to 30 days.
Sizes
5mg

Sequence

PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG (32 amino acids; containing p53 HDM-2-binding domain fused to membrane residency peptide)

Research Use Only. This product is intended for laboratory research purposes only. Not for human consumption. Handle with appropriate safety precautions.

Request QuoteBulk Pricing Inquiry

Related Peptides

AICAR - MiPeptidos
Ships Today
Specialty / Research

AICAR

5-Aminoimidazole-4-carboxamide ribonucleotide, an AMP-activated protein kinase (AMPK) activator. Studied for metabolic regulation, exercise mimicry, and cellular energy sensing research.

From$22.95/vial
2 sizesIn Stock
≥99%
ARA290 (Cibinetide) - MiPeptidos
Ships Today
Specialty / Research

ARA290 (Cibinetide)

An 11-amino acid peptide that selectively activates the innate repair receptor (IRR). Investigated for tissue-protective and anti-inflammatory signaling without erythropoietic activity.

From$28.95/vial
2 sizesIn Stock
≥99%
ACE 031 - MiPeptidos
Ships Today
Specialty / Research

ACE 031

A soluble form of activin receptor type IIB (ActRIIB) fused to an IgG1 Fc domain. Researched as a myostatin trap for muscle growth and neuromuscular disease studies.

From$13.95/vial
In Stock
≥99%
ACTH 1-39 - MiPeptidos
Ships Today
Specialty / Research

ACTH 1-39

Full-length adrenocorticotropic hormone, a 39-amino acid polypeptide. The primary regulator of adrenal cortisol production, used in HPA axis and steroidogenesis research.

From$25.95/vial
In Stock
≥99%