ACTH 1-39 - Front - MiPeptidos
Specialty / Research

ACTH 1-39

CAS: 12279-41-3

ACTH 1-39 is a research peptide in the specialty / research category. ACTH is a 39-amino acid polypeptide hormone produced by the anterior pituitary via cleavage of proopiomelanocortin (POMC). MiPeptidos offers ACTH 1-39 in 1 sizes with 99.2% verified purity and full analytical documentation.

Starting at
$25.95/vial
In Stock
Ships same day
Request Quote
≥99% Purity
COA Included
Third-Party Tested
Same-Day Shipping
CoA Included
HPLC Verified
GMP Compliant
Third-Party Tested
Same-Day Shipping
Batch Tracked

How ACTH 1-39 Works

ACTH is a 39-amino acid polypeptide hormone produced by the anterior pituitary via cleavage of proopiomelanocortin (POMC). It binds to melanocortin 2 receptors (MC2R) on adrenal cortical cells, activating adenylyl cyclase and the PKA pathway to stimulate steroidogenesis, primarily cortisol production. The first 24 amino acids contain the full biological activity. ACTH also has melanotropic activity (via MC1R), immunomodulatory effects, and influences lipid metabolism. It is the primary regulator of the hypothalamic-pituitary-adrenal (HPA) axis.

Research Applications

1
Adrenal function testing (ACTH stimulation test)
2
HPA axis physiology
3
Steroidogenesis regulation
4
Infantile spasms treatment (clinical use)
5
Melanocortin receptor pharmacology
View Published Research on PubMed →

Pricing

SizePer Vial10-Pack
5mg
$25.95$188.95

Prices shown per vial from 10-pack. Volume discounts available for 50+ vials — contact us.

HPLC Purity Analysis

High-Performance Liquid Chromatography
99.2%purity
mAURetention Time (min)0250500750100005101520253099.2%
Method: RP-HPLC C18 ColumnDetection: UV 220nmMobile Phase: Acetonitrile/Water + 0.1% TFA

Certificate of Analysis

MiPeptidos
ACTH 1-39
PASSES ALL SPECIFICATIONS
Batch NumberHR-CTH1-2600115
Date of AnalysisMarch 2, 2026
Purity (HPLC)99.2%
AppearanceWhite to off-white lyophilized powder
SolubilityFreely soluble in sterile water and bacteriostatic water
Molecular Weight (MS)4541.07 Da — Confirmed
Endotoxin (LAL)<0.1 EU/mg
Sterility (USP <71>)Passes USP <71>

This COA is a representative sample. A batch-specific Certificate of Analysis with full HPLC chromatograms and mass spectrometry data is included with every MiPeptidos order.

Reconstitution Calculator

Add this much bacteriostatic water:
5.0 mL
5 mg ACTH 1-39 + 5.0 mL BAC water = 1 mg/mL

Inject bacteriostatic water slowly along the vial wall. Gently swirl until dissolved — never shake. Store reconstituted solution at 2-8°C and use within 30 days.

Download Product Brochure

Get our detailed ACTH 1-39 product brochure with specifications, research applications, HPLC analysis data, and reconstitution guide. Available in English and Spanish.

Customer Reviews

4.0/5from 1 review
Verified
Dr. Margaret O'Sullivan·Cork, Ireland

Full-length ACTH(1-39) from MiPeptidos drives our adrenocortical stimulation studies. The 39-residue peptide shows proper melanocortin-2 receptor activation and cortisol release in our adrenal cell models. Four stars bec...

Feb 18, 2026
View All Reviews →

Frequently Asked Questions

ACTH 1-39 (CAS: 12279-41-3) is a research compound, with a molecular weight of 4541.07 Da in the Specialty / Research category. ACTH is a 39-amino acid polypeptide hormone produced by the anterior pituitary via cleavage of proopiomelanocortin (POMC). It binds to melanocortin 2 receptors (MC2R) on adrenal cortical cells, activating adenylyl cyclase and the PKA pathway to stimulate steroidogenesis, primarily cortisol production. Researchers commonly investigate ACTH 1-39 for Adrenal function testing (ACTH stimulation test), HPA axis physiology, Steroidogenesis regulation. Every vial from MiPeptidos includes batch-specific analytical documentation.
To reconstitute your ACTH 1-39 5mg vial, let it reach room temperature for about 15-20 minutes out of the freezer. Slowly inject 1-2mL of bacteriostatic water along the inside wall of the vial — never aim directly at the peptide cake. Gently swirl until the powder fully dissolves; never shake, as this can denature the peptide. Store reconstituted ACTH 1-39 at 2-8°C and use within 30 days. MiPeptidos includes bacteriostatic water for purchase alongside all peptides.
ACTH 1-39 is the complete 39-amino acid adrenocorticotropic hormone (4541 Da) that stimulates cortisol production from the adrenal cortex via MC2R receptors. Semax is a modified fragment of ACTH (residues 4-10, with stabilizing extensions) that targets brain melanocortin receptors for nootropic effects without adrenal stimulation. Full ACTH has potent steroidogenic activity; Semax has purely neurotrophic activity. MiPeptidos offers both for melanocortin pathway research at different levels.
Store lyophilized ACTH 1-39 at -20°C for maximum long-term stability — properly stored, it remains potent for 24+ months. Once reconstituted with bacteriostatic water, keep it refrigerated at 2-8°C and use within 30 days. In research applications, ACTH 1-39 has a reported half-life of ~10-15 minutes, which informs dosing frequency and protocol design. Avoid repeated freeze-thaw cycles and protect from direct light. MiPeptidos ships every order with cold-chain packaging to maintain integrity during transit.
Every ACTH 1-39 order from MiPeptidos includes a batch-specific Certificate of Analysis. Our current batch (HR-CTH1-2600115, tested March 2, 2026) shows 99.2% purity by HPLC, mass spectrometry confirmation at 4541.07 Da, endotoxin levels below 0.1 EU/mg, and passing sterility per USP <71>. This level of documentation ensures you can verify compound identity and purity before beginning your research. MiPeptidos also offers bulk pricing on orders of 50+ vials — contact info@mipeptidos.com.

Specifications

Purity
≥99%
Form
Lyophilized Powder
CAS Number
12279-41-3
Mol. Weight
4541.07 Da
Formula
C207H308N56O58S
Half-Life
~10-15 minutes
Storage
Store at -20°C. Reconstituted: 2–8°C for up to 30 days.
Sizes
5mg

Sequence

SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF (39 amino acids)

Research Use Only. This product is intended for laboratory research purposes only. Not for human consumption. Handle with appropriate safety precautions.

Request QuoteBulk Pricing Inquiry

Related Peptides

AICAR - MiPeptidos
Ships Today
Specialty / Research

AICAR

5-Aminoimidazole-4-carboxamide ribonucleotide, an AMP-activated protein kinase (AMPK) activator. Studied for metabolic regulation, exercise mimicry, and cellular energy sensing research.

From$22.95/vial
2 sizesIn Stock
≥99%
ARA290 (Cibinetide) - MiPeptidos
Ships Today
Specialty / Research

ARA290 (Cibinetide)

An 11-amino acid peptide that selectively activates the innate repair receptor (IRR). Investigated for tissue-protective and anti-inflammatory signaling without erythropoietic activity.

From$28.95/vial
2 sizesIn Stock
≥99%
ACE 031 - MiPeptidos
Ships Today
Specialty / Research

ACE 031

A soluble form of activin receptor type IIB (ActRIIB) fused to an IgG1 Fc domain. Researched as a myostatin trap for muscle growth and neuromuscular disease studies.

From$13.95/vial
In Stock
≥99%
Cardiogen - MiPeptidos
Ships Today
Specialty / Research

Cardiogen

A short peptide bioregulator studied for cardiovascular tissue research. Investigated for its effects on cardiac cell differentiation and myocardial tissue models.

From$39.95/vial
In Stock
≥99%