FOX04 - Front - MiPeptidos
Anti-Aging / Longevity

FOX04

CAS: 2460055-10-9

FOX04 is a research peptide in the anti-aging / longevity category. FOXO4-DRI is a retro-inverso peptide (D-amino acid mirror image in reverse sequence) designed to disrupt the interaction between FOXO4 and p53 in senescent cells. MiPeptidos offers FOX04 in 2 sizes with 99.4% verified purity and full analytical documentation.

Starting at
$39.95/vial
In Stock
Ships same day
Request Quote
≥99% Purity
COA Included
Third-Party Tested
Same-Day Shipping
CoA Included
HPLC Verified
GMP Compliant
Third-Party Tested
Same-Day Shipping
Batch Tracked

How FOX04 Works

FOXO4-DRI is a retro-inverso peptide (D-amino acid mirror image in reverse sequence) designed to disrupt the interaction between FOXO4 and p53 in senescent cells. In cellular senescence, FOXO4 accumulates in the nucleus and sequesters p53, preventing p53-mediated apoptosis and keeping senescent cells alive. FOXO4-DRI competitively blocks this interaction, freeing p53 to trigger apoptosis selectively in senescent cells while sparing healthy cells. This makes it a targeted senolytic agent.

Research Applications

1
Senescent cell clearance (senolytic therapy)
2
Aging reversal and rejuvenation
3
FOXO4/p53 interaction biology
4
Age-related organ deterioration
5
Retro-inverso peptide drug design
View Published Research on PubMed →

Pricing

SizePer Vial10-Pack
2mg
$39.95$291.95
10mgBest Value
$144.95$1057.95

Prices shown per vial from 10-pack. Volume discounts available for 50+ vials — contact us.

HPLC Purity Analysis

High-Performance Liquid Chromatography
99.4%purity
mAURetention Time (min)0250500750100005101520253099.4%
Method: RP-HPLC C18 ColumnDetection: UV 220nmMobile Phase: Acetonitrile/Water + 0.1% TFA

Certificate of Analysis

MiPeptidos
FOX04
PASSES ALL SPECIFICATIONS
Batch NumberHR-FX04-2600315
Date of AnalysisFebruary 20, 2026
Purity (HPLC)99.4%
AppearanceWhite to off-white lyophilized powder
SolubilityFreely soluble in sterile water and bacteriostatic water
Molecular Weight (MS)5358.05 Da — Confirmed
Endotoxin (LAL)<0.1 EU/mg
Sterility (USP <71>)Passes USP <71>

This COA is a representative sample. A batch-specific Certificate of Analysis with full HPLC chromatograms and mass spectrometry data is included with every MiPeptidos order.

Reconstitution Calculator

Add this much bacteriostatic water:
2.0 mL
2 mg FOX04 + 2.0 mL BAC water = 1 mg/mL

Inject bacteriostatic water slowly along the vial wall. Gently swirl until dissolved — never shake. Store reconstituted solution at 2-8°C and use within 30 days.

Download Product Brochure

Get our detailed FOX04 product brochure with specifications, research applications, HPLC analysis data, and reconstitution guide. Available in English and Spanish.

Customer Reviews

5.0/5from 1 review
Verified
Henrik Nilsson·Stockholm, Sweden

FOXO4 peptide from MiPeptidos is our primary tool for senescent cell research. The peptide disrupts the FOXO4-p53 interaction in our senescence assays with high specificity. This is advanced aging research material and t...

Dec 28, 2025
View All Reviews →

Frequently Asked Questions

FOX04 (CAS: 2460055-10-9) is a research compound, with a molecular weight of 5358.05 Da in the Anti-Aging / Longevity category. FOXO4-DRI is a retro-inverso peptide (D-amino acid mirror image in reverse sequence) designed to disrupt the interaction between FOXO4 and p53 in senescent cells. In cellular senescence, FOXO4 accumulates in the nucleus and sequesters p53, preventing p53-mediated apoptosis and keeping senescent cells alive. Researchers commonly investigate FOX04 for Senescent cell clearance (senolytic therapy), Aging reversal and rejuvenation, FOXO4/p53 interaction biology. Every vial from MiPeptidos includes batch-specific analytical documentation.
FOX04 is available in 2 sizes (2mg, 10mg), so reconstitution volume depends on which vial you have. For the 2mg size, add 1mL of bacteriostatic water; for the 10mg size, use 2-3mL. Always let the vial warm to room temperature first, inject the water slowly along the vial wall, and swirl gently — never shake. Store reconstituted FOX04 at 2-8°C and use within 30 days. MiPeptidos carries bacteriostatic water in 3mL and 10mL vials.
FOX04 and FOXO4-DRI refer to the same compound — FOXO4-D-Retro-Inverso. This is a D-amino acid retroinverso peptide that disrupts the FOXO4-p53 interaction in senescent cells, forcing them into apoptosis while sparing healthy cells. The D-retro-inverso design makes it protease-resistant with dramatically extended stability. MiPeptidos lists it in two formats for researcher convenience, with the FOX04 listing offering 2mg and 5mg sizes.
Store lyophilized FOX04 at -20°C for maximum long-term stability — properly stored, it remains potent for 24+ months. Once reconstituted with bacteriostatic water, keep it refrigerated at 2-8°C and use within 30 days. In research applications, FOX04 has a reported half-life of Extended (D-amino acids resist proteolytic degradation); exact PK not fully published, which informs dosing frequency and protocol design. Avoid repeated freeze-thaw cycles and protect from direct light. MiPeptidos ships every order with cold-chain packaging to maintain integrity during transit.
Every FOX04 order from MiPeptidos includes a batch-specific Certificate of Analysis. Our current batch (HR-FX04-2600315, tested February 20, 2026) shows 99.4% purity by HPLC, mass spectrometry confirmation at 5358.05 Da, endotoxin levels below 0.1 EU/mg, and passing sterility per USP <71>. This level of documentation ensures you can verify compound identity and purity before beginning your research. MiPeptidos also offers bulk pricing on orders of 50+ vials — contact info@mipeptidos.com.

Specifications

Purity
≥99%
Form
Lyophilized Powder
CAS Number
2460055-10-9
Mol. Weight
5358.05 Da
Formula
C228H388N86O64
Half-Life
Extended (D-amino acids resist proteolytic degradation); exact PK not fully published
Storage
Store at -20°C. Reconstituted: 2–8°C for up to 30 days.
Sizes
2mg, 10mg

Sequence

ltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg (46 amino acids; all D-amino acids in retro-inverso configuration)

Research Use Only. This product is intended for laboratory research purposes only. Not for human consumption. Handle with appropriate safety precautions.

Request QuoteBulk Pricing Inquiry

Related Peptides

Epithalon - MiPeptidos
Best Seller
Ships Today
Anti-Aging / Longevity

Epithalon

A synthetic tetrapeptide based on the natural epithalamin produced by the pineal gland. Studied for telomerase activation, telomere elongation, and circadian rhythm regulation.

From$14.95/vial
2 sizesIn Stock
≥99%
MOTS-c - MiPeptidos
Staff Pick
Ships Today
Anti-Aging / Longevity

MOTS-c

A mitochondria-derived peptide encoded within the 12S rRNA gene. Researched for its roles in metabolic homeostasis, exercise mimicry, and age-related metabolic decline.

From$64.95/vial
4 sizesIn Stock
≥99%
Humanin - MiPeptidos
Ships Today
Anti-Aging / Longevity

Humanin

A mitochondria-derived micropeptide with cytoprotective properties. Studied for neuroprotection, cellular stress resistance, and as a biomarker for aging research.

From$126.95/vial
In Stock
≥99%
SS-31 - MiPeptidos
Ships Today
Anti-Aging / Longevity

SS-31

Also known as Elamipretide, a mitochondria-targeted tetrapeptide. Researched for its ability to stabilize cardiolipin in the inner mitochondrial membrane and restore bioenergetics.

From$25.95/vial
2 sizesIn Stock
≥99%