Gana 10 pts/$1 + 500 puntos de bonificación al registrarte|
Researcher Starter Kit research kit - MiPeptidos
Resumen de Investigación de Researcher Starter Kit
Descarga gratuita — resumen bibliográfico en PDF
Resumen bibliográficoDatos HPLCPMIDs + citasEN + ES

Sin spam. Cancela en cualquier momento.

Prueba analítica

Pureza por lote, justo donde los investigadores la buscan.

Cada compuesto incluido muestra su resultado HPLC, referencia de lote y fecha de prueba para que el research brief esté respaldado por evidencia analítica real.

BPC 157

Pureza (HPLC)

99.4%
HR-BPC1-2600215
RP-HPLC C18March 20, 2026

TB500

Pureza (HPLC)

99.8%
HR-TB50-2600315
RP-HPLC C18March 28, 2026

Bacteriostatic Water

Pureza (HPLC)

99.4%
HR-BCTR-2600315
RP-HPLC C18January 12, 2026
PrincipianteSave 10%

Researcher Starter Kit

Designed as the cleanest starting point for researchers entering peptide work

Todo lo que un investigador necesita para comenzar estudios con péptidos.

Entry-point kit with two widely recognized repair compounds
Includes bacteriostatic water so the setup is complete from the start
Smaller sizes make it easier to begin comparative research without overbuying
Built around one of the most familiar pairings in repair literature
Solo para Uso en Investigación.

Solo para Uso en Investigación. Estos kits están destinados únicamente para fines de investigación en laboratorio. No para consumo humano. Los resúmenes públicos reflejan literatura publicada y documentación analítica, no instrucciones de uso humano ni claims terapéuticos.

Paquete de Kit
USD 90.81
USD 100.90
Ahorra USD 10.09 (10% off)
BPC 157 (5mg)
USD 49.95
TB500 (5mg)
USD 38.95
Bacteriostatic Water (10ml)
USD 12.00
COA Incluido
Verificado por HPLC
Envío el Mismo Día
Pruebas de Terceros
Transacciones Seguras· SSL de 256 bits
VISA
AMEX
DISC
Pay
Crypto
COA Incluido
Verificado por HPLC
Cumple con GMP
Pruebas de Terceros
Envío el Mismo Día
Lote Rastreado
Resumen de evidencia

Construido desde investigación publicada, no desde suposiciones.

Cada kit público ahora abre con la prueba: estudios citados, PMIDs, señales rastreadas y documentación por lote en cada componente.

Ventana de observación
8 semanas
Fases de estudio
Estructurado
Endpoints rastreados
4
Rango de publicación
Literatura actual
Estudios destacados
3
PMIDs en página
2
Señales de investigación
4
COAs incluidos
3
Arquitectura del compuesto

Qué hay dentro del kit, a nivel estructural

Detalles químicos clave tomados de cada compuesto incluido para que la página se sienta como un perfil de investigación real, no como una tarjeta genérica de bundle.

BPC 157

CAS: 137525-51-0

BPC-157 is a synthetic 15-amino acid fragment derived from human gastric body protection compound. It promotes angiogenesis by upregulating VEGF and its receptor VEGFR2, activates the FAK-paxillin pathway to enhance cell migration and wound closure, and modulates the nitric oxide system. It also interacts with the dopaminergic system and has cytoprotective effects on gastrointestinal mucosa, tendons, ligaments, and other connective tissues.

Fórmula molecular
C62H98N16O22
Peso molecular
1419.56 Da
Secuencia
Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val (15 amino acids)

TB500

CAS: 77591-33-4 (Thymosin Beta-4); 885340-08-9 (synthetic TB-500 fragment)

TB-500 (synthetic thymosin beta-4) is studied for its role in actin dynamics, a core process that helps cells migrate, reorganize, and respond to repair signals. Published literature has examined its interaction with angiogenic signaling, inflammatory pathways, and tissue-remodeling biology across multiple preclinical models. The active region LKKTETQ is considered central to its actin-binding activity.

Fórmula molecular
C212H350N56O78S
Peso molecular
4963.44 Da (full Thymosin Beta-4)
Secuencia
Full TB4: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETTIEQEKQAGES (43 amino acids); Active region: LKKTETQ (residues 17-23)

Bacteriostatic Water

CAS: 7732-18-5 (water); contains 0.9% benzyl alcohol (CAS 100-51-6) as preservative

Bacteriostatic water is sterile water for injection containing 0.9% benzyl alcohol as a bacteriostatic preservative. The benzyl alcohol inhibits bacterial growth, allowing the vial to be used for multiple reconstitutions over an extended period. It is used as a diluent for reconstituting lyophilized peptides and medications. The benzyl alcohol disrupts bacterial cell membrane integrity and interferes with microbial metabolic processes, preventing contamination of multi-use vials.

Fórmula molecular
H2O (with 0.9% C7H8O benzyl alcohol)
Peso molecular
18.02 Da (water)
Secuencia
N/A (not a peptide; sterile diluent)

Parámetros de estudio publicados

Rangos de dosis, intervalos y rutas de administración citados típicamente en la literatura para los compuestos de este kit.

Notas del Protocolo de Investigación

Standard reconstitution protocols call for 2ml of bacteriostatic water per vial. Doses are drawn with an insulin syringe. Reconstituted peptides are stored refrigerated per stability data. BPC-157 is most commonly administered near the injury site. Both peptides can be combined in the same syringe.

BPC 157

Morning, fasted
Rangos de dosis citados
250mcg
Intervalos citados
1-2x daily
Rutas citadas
Subcutaneous at studied administration sites

TB500

reported study windows
Rangos de dosis citados
2mg
Intervalos citados
2x per week
Rutas citadas
Subcutaneous

Bacteriostatic Water

Prior to first use
Rangos de dosis citados
2ml per vial
Intervalos citados
For reconstitution
Rutas citadas
Reconstitution

Estos son parámetros de estudio resumidos a partir de literatura citada y diseños de investigación. Se presentan solo como contexto de investigación, no como instrucciones ni recomendaciones de uso humano.

Por qué existe este kit

Por qué estos compuestos se combinan en la literatura

Resúmenes en lenguaje claro de los mecanismos y combinaciones publicadas que hacen que este kit tenga sentido para investigación real.

1
BPC 157

BPC-157 is the most widely researched repair biology peptide in published literature, with studies demonstrating effects on gut mucosal integrity, joint repair-signaling research, and inflammatory modulation (PMID: 29356623).

2
TB500

TB500 (Thymosin Beta-4) is shown in research to complement BPC-157 through cellular migration and inflammatory-pathway mechanisms — making them the most frequently co-studied peptide pairing in repair-signaling research literature (PMID: 20816543).

3
Bacteriostatic Water

Bacteriostatic water is included as the standard diluent for peptide reconstitution — no separate purchase needed to begin research immediately.

Lectura por péptido

Profundiza en los péptidos dentro del kit

Selección de artículos ligada directamente a los compuestos de este kit, para que el investigador pase del bundle a la literatura, el mecanismo y el manejo específico de cada péptido.

Ver la biblioteca completa

Comienza tu Investigación

Get the complete Researcher Starter Kit at $90.81 — save $10.09 versus purchasing each compound separately. Full COA documentation included with every vial.

Solo para Uso en Investigación. Estos kits están destinados únicamente para fines de investigación en laboratorio. No para consumo humano. Los resúmenes públicos reflejan literatura publicada y documentación analítica, no instrucciones de uso humano ni claims terapéuticos.