Gana 10 pts/$1 + 500 puntos de bonificación al registrarte|
Top Sellers Mega Pack research kit - MiPeptidos
Resumen de Investigación de Top Sellers Mega Pack
Descarga gratuita — resumen bibliográfico en PDF
Resumen bibliográficoDatos HPLCPMIDs + citasEN + ES

Sin spam. Cancela en cualquier momento.

Prueba analítica

Pureza por lote, justo donde los investigadores la buscan.

Cada compuesto incluido muestra su resultado HPLC, referencia de lote y fecha de prueba para que el research brief esté respaldado por evidencia analítica real.

BPC-157 10mg

Pureza (HPLC)

99.4%
HR-BPC1-2600215
RP-HPLC C18March 20, 2026

TB500 10mg

Pureza (HPLC)

99.8%
HR-TB50-2600315
RP-HPLC C18March 28, 2026

Semaglutide 10mg

Pureza (HPLC)

99.1%
HR-SMGL-2600315
RP-HPLC C18January 21, 2026

Tirzepatide 10mg

Pureza (HPLC)

99.2%
HR-TRZP-2600315
RP-HPLC C18January 2, 2026

Ipamorelin 5mg

Pureza (HPLC)

99.7%
HR-PMRL-2600215
RP-HPLC C18February 27, 2026
Best SellersSave 20%

Top Sellers Mega Pack

Our 5 highest-volume peptides in 20-packs each

100 vials of the 5 top sellers at 20-pack pricing.

20x BPC-157 10mg — fastest mover in repair-signaling research
20x TB500 10mg — #2 seller, pairs with BPC-157
20x Semaglutide 10mg — GLP-1 leader, highest patient demand
20x Tirzepatide 10mg — dual agonist, growing fast
Solo para Uso en Investigación.

Solo para Uso en Investigación. Estos kits están destinados únicamente para fines de investigación en laboratorio. No para consumo humano. Los resúmenes públicos reflejan literatura publicada y documentación analítica, no instrucciones de uso humano ni claims terapéuticos.

Paquete de Kit
USD 4,999.00
USD 520.75
Ahorra -USD 4,478.25 (20% off)
BPC-157 10mg (10mg)
USD 67.95
TB500 10mg (10mg)
USD 99.95
Semaglutide 10mg (10mg)
USD 86.95
Tirzepatide 10mg (10mg)
USD 224.95
Ipamorelin 5mg (5mg)
USD 40.95
COA Incluido
Verificado por HPLC
Envío el Mismo Día
Pruebas de Terceros
Transacciones Seguras· SSL de 256 bits
VISA
AMEX
DISC
Pay
Crypto
COA Incluido
Verificado por HPLC
Cumple con GMP
Pruebas de Terceros
Envío el Mismo Día
Lote Rastreado
Resumen de evidencia

Construido desde investigación publicada, no desde suposiciones.

Cada kit público ahora abre con la prueba: estudios citados, PMIDs, señales rastreadas y documentación por lote en cada componente.

Ventana de observación
8 semanas
Fases de estudio
Estructurado
Endpoints rastreados
4
Rango de publicación
Literatura actual
Estudios destacados
3
PMIDs en página
2
Señales de investigación
4
COAs incluidos
5
Arquitectura del compuesto

Qué hay dentro del kit, a nivel estructural

Detalles químicos clave tomados de cada compuesto incluido para que la página se sienta como un perfil de investigación real, no como una tarjeta genérica de bundle.

BPC-157 10mg

CAS: 137525-51-0

BPC-157 is a synthetic 15-amino acid fragment derived from human gastric body protection compound. It promotes angiogenesis by upregulating VEGF and its receptor VEGFR2, activates the FAK-paxillin pathway to enhance cell migration and wound closure, and modulates the nitric oxide system. It also interacts with the dopaminergic system and has cytoprotective effects on gastrointestinal mucosa, tendons, ligaments, and other connective tissues.

Fórmula molecular
C62H98N16O22
Peso molecular
1419.56 Da
Secuencia
Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val (15 amino acids)

TB500 10mg

CAS: 77591-33-4 (Thymosin Beta-4); 885340-08-9 (synthetic TB-500 fragment)

TB-500 (synthetic thymosin beta-4) is studied for its role in actin dynamics, a core process that helps cells migrate, reorganize, and respond to repair signals. Published literature has examined its interaction with angiogenic signaling, inflammatory pathways, and tissue-remodeling biology across multiple preclinical models. The active region LKKTETQ is considered central to its actin-binding activity.

Fórmula molecular
C212H350N56O78S
Peso molecular
4963.44 Da (full Thymosin Beta-4)
Secuencia
Full TB4: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETTIEQEKQAGES (43 amino acids); Active region: LKKTETQ (residues 17-23)

Semaglutide 10mg

CAS: 910463-68-2

Semaglutide is a GLP-1 receptor agonist that mimics native GLP-1 to stimulate insulin secretion in a glucose-dependent manner while suppressing glucagon release. The Aib substitution at position 2 confers resistance to DPP-IV enzymatic degradation, and the C18 fatty diacid chain enables high-affinity albumin binding, extending its half-life substantially. It also acts on hypothalamic appetite centers to reduce food intake and delay gastric emptying.

Fórmula molecular
C187H291N45O59
Peso molecular
4113.64 Da
Secuencia
Modified GLP-1(7-37) analog; 31 amino acids with Aib at position 8, Arg at position 34, and a C18 fatty diacid chain via linker at Lys26

Tirzepatide 10mg

CAS: 2023788-19-2

Tirzepatide is a dual GIP and GLP-1 receptor agonist that activates both incretin pathways simultaneously. It stimulates insulin secretion, suppresses glucagon in a glucose-dependent manner, and reduces appetite via central and peripheral signaling. The dual receptor engagement provides synergistic metabolic effects beyond GLP-1 agonism alone, including enhanced lipid metabolism and improved insulin sensitivity.

Fórmula molecular
C225H348N48O68
Peso molecular
4813.45 Da
Secuencia
39-amino acid peptide based on GIP sequence with Aib at positions 2 and 13, and a C20 fatty diacid chain conjugated to Lys20 via a linker; C-terminal amidation

Ipamorelin 5mg

CAS: 170851-70-4

Ipamorelin is a highly selective growth hormone secretagogue that acts on the ghrelin/GHS receptor (GHSR) in the pituitary to stimulate pulsatile GH release. Unlike other GHRPs, ipamorelin does not significantly affect cortisol, ACTH, or prolactin levels at GH-releasing doses, making it the most selective GHS available. It works synergistically with GHRH analogs (like CJC-1295) to amplify GH pulses while maintaining the natural pulsatile release pattern.

Fórmula molecular
C38H49N9O5
Peso molecular
711.85 Da
Secuencia
Aib-His-D-2-Nal-D-Phe-Lys-NH2 (pentapeptide with non-natural amino acids)
Por qué existe este kit

Por qué estos compuestos se combinan en la literatura

Resúmenes en lenguaje claro de los mecanismos y combinaciones publicadas que hacen que este kit tenga sentido para investigación real.

1
BPC-157 10mg

Our 5 highest-volume peptides in 20-packs each. BPC-157, TB500, Semaglutide, Tirzepatide, and Ipamorelin — the compounds every clinic moves the most of. Double inventory depth at the best per-vial cost we offer.

Péptidos Incluidos

Qué Incluye Este Kit

5 péptidos, cada uno con documentación COA individual

BPC-157 10mg

BPC-157 10mg

$67.95

Tendon, ligament, and muscle repair biology · Gastrointestinal ulcer and IBD research · Neuroprotection and nerve regeneration

BPC-157 is a synthetic 15-amino acid fragment derived from human gastric body protection compound.

10mgHealing / Recovery
TB500 10mg

TB500 10mg

$99.95

Dermal wound-repair biology models · Cardiac injury and migration signaling research · Inflammatory pathway and remodeling studies

TB-500 (synthetic thymosin beta-4) is studied for its role in actin dynamics, a core process that helps cells migrate, reorganize, and respond to repair signals.

10mgHealing / Recovery
Semaglutide 10mg

Semaglutide 10mg

$86.95

glucose-regulation research glucose-regulation research · energy-balance research and metabolic signaling research · cardiometabolic research in diabetic populations

Semaglutide is a GLP-1 receptor agonist that mimics native GLP-1 to stimulate insulin secretion in a glucose-dependent manner while suppressing glucagon release.

10mgGLP-1 / Weight Management
Tirzepatide 10mg

Tirzepatide 10mg

$224.95

glucose-regulation research with superior HbA1c reduction · energy-balance research treatment with significant metabolic research outcomes · Dual incretin receptor pharmacology studies

Tirzepatide is a dual GIP and GLP-1 receptor agonist that activates both incretin pathways simultaneously.

10mgGLP-1 / Weight Management
Ipamorelin 5mg

Ipamorelin 5mg

$40.95

Selective GH secretion without cortisol elevation · Synergistic combination with GHRH analogs · Bone density and growth studies

Ipamorelin is a highly selective growth hormone secretagogue that acts on the ghrelin/GHS receptor (GHSR) in the pituitary to stimulate pulsatile GH release.

5mgGrowth Hormone / GH Secretagogues
Lectura por péptido

Profundiza en los péptidos dentro del kit

Selección de artículos ligada directamente a los compuestos de este kit, para que el investigador pase del bundle a la literatura, el mecanismo y el manejo específico de cada péptido.

Ver la biblioteca completa

Comienza tu Investigación

Get the complete Top Sellers Mega Pack at $4999.00 — save $-4478.25 versus purchasing each compound separately. Full COA documentation included with every vial.

Solo para Uso en Investigación. Estos kits están destinados únicamente para fines de investigación en laboratorio. No para consumo humano. Los resúmenes públicos reflejan literatura publicada y documentación analítica, no instrucciones de uso humano ni claims terapéuticos.