Earn 10 pts/$1 + 500 bonus points on signup|
Dermal Matrix Research Kit research kit - MiPeptidos
Dermal Matrix Research Kit Research Brief
Free download — literature summary PDF
Literature SummaryHPLC DataPMIDs + CitationsEN + ES

No spam. Unsubscribe anytime.

Analytical proof

Batch purity, right where researchers look for it.

Each included compound carries its own HPLC result, batch reference, and testing date so the research brief is backed by real analytical proof.

BPC 157

Purity (HPLC)

99.4%
HR-BPC1-2600215
RP-HPLC C18March 20, 2026

GHK-Cu

Purity (HPLC)

99.4%
HR-GHKC-2600115
RP-HPLC C18February 28, 2026

TB500

Purity (HPLC)

99.8%
HR-TB50-2600315
RP-HPLC C18March 28, 2026
Dermal ResearchSave 10%

Dermal Matrix Research Kit

Three compounds frequently discussed around dermal repair biology

A dermal research kit built around angiogenic signaling, matrix remodeling, and migration-related biology.

BPC-157 appears in angiogenic and support-pathway literature
GHK-Cu is heavily studied for collagen and extracellular-matrix signaling
TB500 extends the kit into migration and remodeling biology
Designed for dermal research that looks at structure, support, and organization together
Research Use Only.

Research Use Only. These kits are intended for laboratory research purposes only. Not for human consumption. Public-page summaries reflect published literature and analytical documentation, not human-use instructions or treatment claims.

Kit Bundle
$187.07
$207.85
Save $20.78 (10% off)
BPC 157 (10mg)
$67.95
GHK-Cu (50mg)
$39.95
TB500 (10mg)
$99.95
CoA Included
HPLC Verified
Same-Day Shipping
Third-Party Tested
Secured Transactions· 256-bit SSL
VISA
AMEX
DISC
Pay
Crypto
CoA Included
HPLC Verified
GMP Compliant
Third-Party Tested
Same-Day Shipping
Batch Tracked
Evidence snapshot

Built from published research, not guesswork.

Every public research kit now leads with the proof: cited studies, PMIDs, tracked signals, and batch-level documentation across each component.

Observation window
12 weeks
Study phases
Structured
Tracked endpoints
4
Publication span
Current literature
Featured studies
3
PMIDs on page
2
Research signals
4
COAs included
3
Compound architecture

What is inside the kit, structurally

Core chemistry details pulled from each included compound so the page feels like a real research profile, not a generic bundle card.

BPC 157

CAS: 137525-51-0

BPC-157 is a synthetic 15-amino acid fragment derived from human gastric body protection compound. It promotes angiogenesis by upregulating VEGF and its receptor VEGFR2, activates the FAK-paxillin pathway to enhance cell migration and wound closure, and modulates the nitric oxide system. It also interacts with the dopaminergic system and has cytoprotective effects on gastrointestinal mucosa, tendons, ligaments, and other connective tissues.

Molecular formula
C62H98N16O22
Molecular weight
1419.56 Da
Sequence
Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val (15 amino acids)

GHK-Cu

CAS: 49557-75-7

GHK-Cu is a naturally occurring copper-binding tripeptide found in human plasma, saliva, and urine. It functions as a signaling molecule that resets gene expression to a healthier state, upregulating genes involved in antioxidant defense, DNA repair, and tissue remodeling while downregulating inflammatory and tissue-destructive genes. It stimulates collagen synthesis, glycosaminoglycan production, and angiogenesis. The copper ion is essential for activating copper-dependent enzymes like lysyl oxidase (collagen cross-linking) and superoxide dismutase.

Molecular formula
C14H24CuN6O4
Molecular weight
403.93 Da
Sequence
Gly-His-Lys (tripeptide complexed with copper(II) ion)

TB500

CAS: 77591-33-4 (Thymosin Beta-4); 885340-08-9 (synthetic TB-500 fragment)

TB-500 (synthetic thymosin beta-4) is studied for its role in actin dynamics, a core process that helps cells migrate, reorganize, and respond to repair signals. Published literature has examined its interaction with angiogenic signaling, inflammatory pathways, and tissue-remodeling biology across multiple preclinical models. The active region LKKTETQ is considered central to its actin-binding activity.

Molecular formula
C212H350N56O78S
Molecular weight
4963.44 Da (full Thymosin Beta-4)
Sequence
Full TB4: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETTIEQEKQAGES (43 amino acids); Active region: LKKTETQ (residues 17-23)

Published study parameters

Typical dose ranges, intervals, and administration routes cited in the literature for the compounds in this kit.

Research Protocol Notes

BPC-157 and TB500 work systemically via subcutaneous injection. GHK-Cu can be applied topically or injected subcutaneously depending on target area. Published dermatological protocols reference topical GHK-Cu combined with subcutaneous BPC-157 and TB500 as the most studied approach for facial tissue.

BPC 157

Morning
Dose ranges cited
250-500mcg
Intervals cited
Daily
Routes cited
Subcutaneous

GHK-Cu

Evening
Dose ranges cited
1-2mg
Intervals cited
Daily
Routes cited
Subcutaneous or topical

TB500

Any time
Dose ranges cited
2-5mg
Intervals cited
2x per week
Routes cited
Subcutaneous

These are publication-style study parameters summarized from cited literature and investigational designs. They are provided as research context only, not as human-use instructions or recommendations.

Why this kit exists

Why these compounds are paired in the literature

Plain-English summaries of the mechanisms and published pairings that make this kit coherent for real research work.

1
BPC 157

Research shows BPC-157 promotes angiogenesis, increasing blood supply delivery of nutrients and oxygen to tissue — a foundational mechanism in skin repair studies (PMID: 29356623).

2
GHK-Cu

GHK-Cu is among the most extensively studied skin peptides in literature, shown to stimulate collagen synthesis, activate tissue remodeling genes, and support dermal matrix integrity (PMID: 29658712).

3
TB500

Studies demonstrate TB500 promotes cellular migration to damaged tissue and modulates inflammatory responses — mechanisms relevant to reducing erythema and scar formation in research models (PMID: 20816543).

Peptide reading

Go deeper on the peptides inside the kit

Article picks tied directly to the compounds in this kit, so researchers can move from the bundle view into peptide-specific literature, mechanism, and handling context.

Browse the full research library

Start Your Research

Get the complete Dermal Matrix Research Kit at $187.07 — save $20.78 versus purchasing each compound separately. Full COA documentation included with every vial.

Research Use Only. These kits are intended for laboratory research purposes only. Not for human consumption. Public-page summaries reflect published literature and analytical documentation, not human-use instructions or treatment claims.