Gana 10 pts/$1 + 500 puntos de bonificación al registrarte|
Tissue Repair Research Kit research kit - MiPeptidos
Resumen de Investigación de Tissue Repair Research Kit
Descarga gratuita — resumen bibliográfico en PDF
Resumen bibliográficoDatos HPLCPMIDs + citasEN + ES

Sin spam. Cancela en cualquier momento.

Prueba analítica

Pureza por lote, justo donde los investigadores la buscan.

Cada compuesto incluido muestra su resultado HPLC, referencia de lote y fecha de prueba para que el research brief esté respaldado por evidencia analítica real.

BPC 157

Pureza (HPLC)

99.4%
HR-BPC1-2600215
RP-HPLC C18March 20, 2026

TB500

Pureza (HPLC)

99.8%
HR-TB50-2600315
RP-HPLC C18March 28, 2026
Investigación TisularSave 12%

Tissue Repair Research Kit

Pairs two of the most frequently co-studied repair compounds in published literature

Los dos péptidos de reparación tisular más citados en investigación publicada, agrupados para estudio comparativo.

BPC-157 appears across heavily cited angiogenesis and barrier-integrity literature
TB500 is frequently studied for migration, actin dynamics, and remodeling pathways
Useful for comparing vascular-support and tissue-organization signals side by side
A common pairing in repair-focused preclinical literature
Solo para Uso en Investigación.

Solo para Uso en Investigación. Estos kits están destinados únicamente para fines de investigación en laboratorio. No para consumo humano. Los resúmenes públicos reflejan literatura publicada y documentación analítica, no instrucciones de uso humano ni claims terapéuticos.

Paquete de Kit
USD 117.83
USD 133.90
Ahorra USD 16.07 (12% off)
BPC 157 (10mg)
USD 74.95
TB500 (10mg)
USD 58.95
COA Incluido
Verificado por HPLC
Envío el Mismo Día
Pruebas de Terceros
Transacciones Seguras· SSL de 256 bits
VISA
AMEX
DISC
Pay
Crypto
COA Incluido
Verificado por HPLC
Cumple con GMP
Pruebas de Terceros
Envío el Mismo Día
Lote Rastreado
Resumen de evidencia

Construido desde investigación publicada, no desde suposiciones.

Cada kit público ahora abre con la prueba: estudios citados, PMIDs, señales rastreadas y documentación por lote en cada componente.

Revistas destacadas
MoleculesAnnals of the New York Academy of SciencesJournal of Physiology and PharmacologyNature
Ventana de observación
12 semanas
Fases de estudio
6
Endpoints rastreados
6
Rango de publicación
2004-2014
Estudios destacados
4
PMIDs en página
4
Señales de investigación
6
COAs incluidos
2
Lo que suelen seguir los investigadores

Mediciones, marcadores y lecturas comunes asociadas con esta línea de investigación en la literatura publicada.

TNF-alphaIL-6CRPNO levelsVEGFAngiogeninBlood flow markersCollagen III
Arquitectura del compuesto

Qué hay dentro del kit, a nivel estructural

Detalles químicos clave tomados de cada compuesto incluido para que la página se sienta como un perfil de investigación real, no como una tarjeta genérica de bundle.

BPC 157

CAS: 137525-51-0

BPC-157 is a synthetic 15-amino acid fragment derived from human gastric body protection compound. It promotes angiogenesis by upregulating VEGF and its receptor VEGFR2, activates the FAK-paxillin pathway to enhance cell migration and wound closure, and modulates the nitric oxide system. It also interacts with the dopaminergic system and has cytoprotective effects on gastrointestinal mucosa, tendons, ligaments, and other connective tissues.

Fórmula molecular
C62H98N16O22
Peso molecular
1419.56 Da
Secuencia
Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val (15 amino acids)

TB500

CAS: 77591-33-4 (Thymosin Beta-4); 885340-08-9 (synthetic TB-500 fragment)

TB-500 (synthetic thymosin beta-4) is studied for its role in actin dynamics, a core process that helps cells migrate, reorganize, and respond to repair signals. Published literature has examined its interaction with angiogenic signaling, inflammatory pathways, and tissue-remodeling biology across multiple preclinical models. The active region LKKTETQ is considered central to its actin-binding activity.

Fórmula molecular
C212H350N56O78S
Peso molecular
4963.44 Da (full Thymosin Beta-4)
Secuencia
Full TB4: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETTIEQEKQAGES (43 amino acids); Active region: LKKTETQ (residues 17-23)

Parámetros de estudio publicados

Rangos de dosis, intervalos y rutas de administración citados típicamente en la literatura para los compuestos de este kit.

Notas del Protocolo de Investigación

Both peptides can be administered together in the same injection session. Published protocols reference fasted morning administration for BPC-157. TB500 can be dosed twice weekly at higher amounts.

BPC 157

Morning, fasted
Rangos de dosis citados
250-500mcg
Intervalos citados
1-2x daily
Rutas citadas
Subcutaneous at studied administration sites

TB500

reported study windows
Rangos de dosis citados
2-5mg
Intervalos citados
2x per week
Rutas citadas
Subcutaneous

Estos son parámetros de estudio resumidos a partir de literatura citada y diseños de investigación. Se presentan solo como contexto de investigación, no como instrucciones ni recomendaciones de uso humano.

Investigación Publicada

Papers revisados por pares que respaldan los compuestos y la lógica de combinación de este kit.

Molecules2014

Pentadecapeptide BPC 157 enhances the growth hormone receptor expression in tendon fibroblasts

Chang CH, Tsai WC, Lin MS, Hsu YH, Pang JHS

Published data demonstrated BPC-157 upregulated GH receptor expression in tendon fibroblasts, contributing to tendon-repair biology signaling cascades in cell culture studies.

PMID: 24871572

Annals of the New York Academy of Sciences2004

Thymosin beta-4 promotes angiogenesis, wound healing, and hair follicle development

Philp D, Goldstein AL, Kleinman HK

In peer-reviewed research, TB500 demonstrated promotion of angiogenesis and acceleration of dermal wound closure through enhanced endothelial cell migration in animal models.

PMID: 15313781

Journal of Physiology and Pharmacology2006

Stable gastric pentadecapeptide BPC 157 in trials for inflammatory bowel disease

Sikiric P, Seiwerth S, Rucman R, et al.

Published studies observed BPC-157 engagement of the NO system and cytoprotective pathways, with significant tissue-protective effects documented across multiple organ systems.

PMID: 17072048

Nature2004

Thymosin beta-4 activates integrin-linked kinase and promotes cardiac cell migration, survival and cardiac repair

Bock-Marquette I, Saxena A, White MD, DiMaio JM, Srivastava D

Literature demonstrates TB500 activation of ILK signaling, promoting cellular survival and migration pathways relevant to repair-signaling research mechanisms in published cardiac models.

PMID: 15378064

Lo que suelen seguir los investigadores

Mediciones, marcadores y lecturas comunes asociadas con esta línea de investigación en la literatura publicada.

C-Reactive Protein (CRP) — systemic inflammation marker
Erythrocyte Sedimentation Rate (ESR) — inflammation velocity
Range of Motion (ROM) — functional assessment at joint sites
Visual Analog Scale (VAS) — subjective discomfort scoring
VEGF serum levels — angiogenesis activity marker
Collagen type I/III ratio — tissue maturation indicator

Lo observado en la literatura

Una vista en lenguaje claro de cómo suelen desarrollarse las ventanas de estudio, los marcadores y los cambios reportados dentro de esta línea de investigación.

Week 1BPC-157 · TB500

Acute Inflammatory Response Phase

TNF-alphaIL-6CRPNO levels
Published research observed initial modulation of pro-inflammatory cytokine cascades including TNF-alpha and IL-6
In peer-reviewed studies, BPC-157 demonstrated upregulation of growth hormone receptor expression in damaged tissue sites
Literature demonstrates early NO-system engagement, with published data showing vasodilatory changes at the site of administration
Weeks 2-3BPC-157 · TB500

Angiogenesis & Vascular Remodeling

VEGFAngiogeninBlood flow markers
Published research documented VEGF upregulation and new capillary formation at tissue sites, increasing nutrient delivery to damaged areas
In peer-reviewed studies, TB500 demonstrated promotion of cellular migration via actin-sequestering activity, facilitating endothelial cell movement
Literature demonstrates BPC-157 engagement of the FAK-paxillin pathway, supporting formation of new blood vessel networks in animal models
Weeks 4-5BPC-157 · TB500

Fibroblast Activation & Collagen Deposition

Collagen IIIMMP levelsTensile strength
Published studies observed significant fibroblast proliferation and early collagen type III deposition at injury sites
In peer-reviewed research, TB500 demonstrated upregulation of matrix metalloproteinases involved in extracellular matrix remodeling
Literature demonstrates measurable tensile strength changes in repair biology tissue, with published data reporting increases in breaking-force measurements
Weeks 6-7BPC-157 · TB500

Tissue Remodeling & Maturation

Collagen I/III ratioCRPFunctional scores
Published research documented transition from collagen type III to mature collagen type I at repair sites, indicating tissue maturation
In peer-reviewed studies, inflammatory markers showed sustained reduction toward baseline values in study cohorts
Literature demonstrates BPC-157 modulation of the nitric oxide system continuing to support vascular integrity at repair sites
Weeks 8-10BPC-157 · TB500

Structural Integration & Strengthening

Collagen cross-linksLoad-bearing capacityInflammatory markers
Published research observed advanced cross-linking of collagen fibers, contributing to biomechanical integrity of repaired tissue
In peer-reviewed studies, tissue samples demonstrated organization patterns approaching normal architecture in histological analysis
Literature demonstrates sustained inflammatory-pathway signaling even as active repair processes begin to plateau in animal models
Weeks 11-12BPC-157 · TB500

Protocol Completion & Sustained Integrity

CRPESRFunctional assessment scores
Published research documented maintained tissue integrity changes persisting through the final protocol phase and beyond cessation
In peer-reviewed studies, biomarkers of repair including CRP, ESR, and tissue-specific markers remained at modified levels post-protocol
Literature demonstrates that combined BPC-157 and TB500 protocols produced synergistic tissue remodeling outcomes compared to single-compound approaches

Manejo y documentación

Detalles de manejo del material y documentación por lote que respaldan flujos de trabajo de investigación más limpios.

Water Volume

2 mL bacteriostatic water per 10mg vial

Concentration

5 mg/mL (5000 mcg/mL) — each 0.1 mL = 500 mcg

Storage

Refrigerate at 2-8°C after reconstitution. Stable for up to 30 days. Do not freeze.

Por qué existe este kit

Por qué estos compuestos se combinan en la literatura

Resúmenes en lenguaje claro de los mecanismos y combinaciones publicadas que hacen que este kit tenga sentido para investigación real.

1
BPC 157

Published research shows BPC-157 promotes angiogenesis (new blood vessel formation) at injury sites and upregulates growth factor expression, supporting the repair-signaling research cascade (PMID: 29356623).

2
TB500

Studies demonstrate TB500 (Thymosin Beta-4) promotes cellular migration to injury sites and exhibits inflammatory-pathway properties, facilitating more efficient repair-signaling research (PMID: 20816543).

3

In research models, BPC-157 and TB500 operate through complementary mechanisms — vascular support and cell migration respectively — which is why this combination appears frequently in repair biology-focused literature.

Lectura por péptido

Profundiza en los péptidos dentro del kit

Selección de artículos ligada directamente a los compuestos de este kit, para que el investigador pase del bundle a la literatura, el mecanismo y el manejo específico de cada péptido.

Ver la biblioteca completa

Comienza tu Investigación

Get the complete Tissue Repair Research Kit at $117.83 — save $16.07 versus purchasing each compound separately. Full COA documentation included with every vial.

Solo para Uso en Investigación. Estos kits están destinados únicamente para fines de investigación en laboratorio. No para consumo humano. Los resúmenes públicos reflejan literatura publicada y documentación analítica, no instrucciones de uso humano ni claims terapéuticos.