VIP - Front - MiPeptidos
Healing / Recovery

VIP

CAS: 40077-57-4

VIP is a research peptide in the healing / recovery category. VIP is a 28-amino acid neuropeptide of the glucagon/secretin superfamily that signals through VPAC1 and VPAC2 G protein-coupled receptors, activating adenylyl cyclase and increasing intracellular cAMP. MiPeptidos offers VIP in 2 sizes with 99.6% verified purity and full analytical documentation.

Starting at
$44.95/vial
In Stock
Ships same day
Request Quote
≥99% Purity
COA Included
Third-Party Tested
Same-Day Shipping
CoA Included
HPLC Verified
GMP Compliant
Third-Party Tested
Same-Day Shipping
Batch Tracked

How VIP Works

VIP is a 28-amino acid neuropeptide of the glucagon/secretin superfamily that signals through VPAC1 and VPAC2 G protein-coupled receptors, activating adenylyl cyclase and increasing intracellular cAMP. It acts as a potent vasodilator, bronchodilator, and anti-inflammatory agent. VIP inhibits macrophage and microglial activation, suppresses pro-inflammatory cytokine production, promotes regulatory T-cell differentiation, and has neuroprotective and immunomodulatory properties across multiple organ systems.

Research Applications

1
Pulmonary arterial hypertension
2
Chronic inflammatory and autoimmune disorders
3
Neuroprotection in Parkinson's and Alzheimer's disease
4
Circadian rhythm and sleep regulation
5
Gastrointestinal motility and secretion
View Published Research on PubMed →

Pricing

SizePer Vial10-Pack
5mg
$44.95$327.95
10mgBest Value
$77.95$568.95

Prices shown per vial from 10-pack. Volume discounts available for 50+ vials — contact us.

HPLC Purity Analysis

High-Performance Liquid Chromatography
99.6%purity
mAURetention Time (min)0250500750100005101520253099.6%
Method: RP-HPLC C18 ColumnDetection: UV 220nmMobile Phase: Acetonitrile/Water + 0.1% TFA

Certificate of Analysis

MiPeptidos
VIP
PASSES ALL SPECIFICATIONS
Batch NumberHR-VIP-2600115
Date of AnalysisFebruary 6, 2026
Purity (HPLC)99.6%
AppearanceWhite to off-white lyophilized powder
SolubilityFreely soluble in sterile water and bacteriostatic water
Molecular Weight (MS)3325.70 Da — Confirmed
Endotoxin (LAL)<0.1 EU/mg
Sterility (USP <71>)Passes USP <71>

This COA is a representative sample. A batch-specific Certificate of Analysis with full HPLC chromatograms and mass spectrometry data is included with every MiPeptidos order.

Reconstitution Calculator

Add this much bacteriostatic water:
5.0 mL
5 mg VIP + 5.0 mL BAC water = 1 mg/mL

Inject bacteriostatic water slowly along the vial wall. Gently swirl until dissolved — never shake. Store reconstituted solution at 2-8°C and use within 30 days.

Download Product Brochure

Get our detailed VIP product brochure with specifications, research applications, HPLC analysis data, and reconstitution guide. Available in English and Spanish.

Customer Reviews

5.0/5from 1 review
Verified
Dr. Jennifer Walsh·Baltimore, MD

Vasoactive intestinal peptide from MiPeptidos is critical for our neuroimmunology research. The 28-residue neuropeptide maintained full bioactivity in our VPAC receptor binding assays. Reconstitution in acetic acid solut...

Feb 19, 2026
View All Reviews →

Frequently Asked Questions

VIP (CAS: 40077-57-4) is a research compound, with a molecular weight of 3325.70 Da in the Healing / Recovery category. VIP is a 28-amino acid neuropeptide of the glucagon/secretin superfamily that signals through VPAC1 and VPAC2 G protein-coupled receptors, activating adenylyl cyclase and increasing intracellular cAMP. It acts as a potent vasodilator, bronchodilator, and anti-inflammatory agent. Researchers commonly investigate VIP for Pulmonary arterial hypertension, Chronic inflammatory and autoimmune disorders, Neuroprotection in Parkinson's and Alzheimer's disease. Every vial from MiPeptidos includes batch-specific analytical documentation.
VIP is available in 2 sizes (5mg, 10mg), so reconstitution volume depends on which vial you have. For the 5mg size, add 1-2mL of bacteriostatic water; for the 10mg size, use 2-3mL. Always let the vial warm to room temperature first, inject the water slowly along the vial wall, and swirl gently — never shake. Store reconstituted VIP at 2-8°C and use within 30 days. MiPeptidos carries bacteriostatic water in 3mL and 10mL vials.
VIP (Vasoactive Intestinal Peptide) and Orexin A are both neuropeptides, but VIP acts primarily through VPAC1/VPAC2 receptors to drive vasodilation, immunomodulation, and circadian rhythm regulation, while Orexin A targets OX1R/OX2R for wakefulness and appetite. VIP is a potent bronchodilator and anti-inflammatory agent with a very short half-life (~1-2 minutes), making sustained-delivery research a key challenge. MiPeptidos carries both neuropeptides for CNS signaling studies.
Store lyophilized VIP at -20°C for maximum long-term stability — properly stored, it remains potent for 24+ months. Once reconstituted with bacteriostatic water, keep it refrigerated at 2-8°C and use within 30 days. In research applications, VIP has a reported half-life of ~1-2 minutes in plasma (rapidly degraded by neutral endopeptidase), which informs dosing frequency and protocol design. Avoid repeated freeze-thaw cycles and protect from direct light. MiPeptidos ships every order with cold-chain packaging to maintain integrity during transit.
Every VIP order from MiPeptidos includes a batch-specific Certificate of Analysis. Our current batch (HR-VIP-2600115, tested February 6, 2026) shows 99.6% purity by HPLC, mass spectrometry confirmation at 3325.70 Da, endotoxin levels below 0.1 EU/mg, and passing sterility per USP <71>. This level of documentation ensures you can verify compound identity and purity before beginning your research. MiPeptidos also offers bulk pricing on orders of 50+ vials — contact info@mipeptidos.com.

Specifications

Purity
≥99%
Form
Lyophilized Powder
CAS Number
40077-57-4
Mol. Weight
3325.70 Da
Formula
C147H238N44O42S
Half-Life
~1-2 minutes in plasma (rapidly degraded by neutral endopeptidase)
Storage
Store at -20°C. Reconstituted: 2–8°C for up to 30 days.
Sizes
5mg, 10mg

Sequence

HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 (28 amino acids, C-terminal amide)

Research Use Only. This product is intended for laboratory research purposes only. Not for human consumption. Handle with appropriate safety precautions.

Request QuoteBulk Pricing Inquiry

Related Peptides

BPC 157 - MiPeptidos
Best Seller
Ships Today
Healing / Recovery

BPC 157

A pentadecapeptide derived from human gastric juice, BPC 157 is one of the most studied peptides in tissue repair research. Investigated for tendon, ligament, muscle, and gut healing.

From$8.95/vial
3 sizesIn Stock
≥99%
TB500 - MiPeptidos
Best Seller
Ships Today
Healing / Recovery

TB500

A synthetic fraction of the naturally occurring thymosin beta-4 protein. Extensively researched for wound healing, tissue repair, and anti-inflammatory properties.

From$16.95/vial
3 sizesIn Stock
≥99%
BPC 5mg + TB 5mg - MiPeptidos
Ships Today
Healing / Recovery

BPC 5mg + TB 5mg

A combination blend of BPC 157 and TB500 in a single vial. Researched for potential synergistic effects in tissue repair and recovery protocols.

From$42.95/vial
In Stock
≥99%
BPC 10mg + TB 10mg - MiPeptidos
Ships Today
Healing / Recovery

BPC 10mg + TB 10mg

A higher-dose combination blend of BPC 157 and TB500. Designed for research requiring larger quantities of both peptides in a convenient single-vial format.

From$74.95/vial
In Stock
≥99%